KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_26880Help
Entry
BJ6T_26880        CDS       T01848                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BJ6T_26880
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BJ6T_26880
Enzymes [BR:bju01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BJ6T_26880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2770387..2770863
Genome map
AA seq 158 aa AA seqDB search
MSVIYDFKANSLLGEEVPMRRFEGQVLLIVNTASKCGFTPQYRGLEDLYRDLSPRGFSVL
GFPCNQFGAQEPGQASEIQAFCSTNYDVTFPLFEKIDVNGAHAHPLYEYLKRQQSGLLGA
SIKWNFTKFLVDRAGKVIARYAPTARPEGLRQQIETLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgatctacgacttcaaggccaactcgcttctcggcgaggaggtgcccatgcgc
cgtttcgaggggcaggtgctcttgatcgtcaacaccgcgagcaaatgcggcttcacgccg
caatatcgcgggctggaggatctctatcgcgacctctcgccgcgcggcttctcggtgctc
ggcttcccctgcaaccagttcggcgcgcaggagccggggcaggcgagcgagatccaggca
ttctgctcgaccaactacgacgtcacctttcccctgttcgagaagatcgacgtcaacggc
gcccacgcgcaccctctgtatgagtacctgaaacgccagcaatccggcctgctgggcgcc
tccatcaaatggaatttcaccaaattcctcgtggaccgtgccggcaaggtgatcgcgcgc
tacgcgccgaccgcccgtcccgaaggattgcggcagcaaatcgagaccctgttatga

DBGET integrated database retrieval system