KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_26880Help
Entry
BJ6T_26880        CDS       T01848                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:bju00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bju00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2770387..2770863
Genome map
AA seq 158 aa AA seqDB search
MSVIYDFKANSLLGEEVPMRRFEGQVLLIVNTASKCGFTPQYRGLEDLYRDLSPRGFSVL
GFPCNQFGAQEPGQASEIQAFCSTNYDVTFPLFEKIDVNGAHAHPLYEYLKRQQSGLLGA
SIKWNFTKFLVDRAGKVIARYAPTARPEGLRQQIETLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgatctacgacttcaaggccaactcgcttctcggcgaggaggtgcccatgcgc
cgtttcgaggggcaggtgctcttgatcgtcaacaccgcgagcaaatgcggcttcacgccg
caatatcgcgggctggaggatctctatcgcgacctctcgccgcgcggcttctcggtgctc
ggcttcccctgcaaccagttcggcgcgcaggagccggggcaggcgagcgagatccaggca
ttctgctcgaccaactacgacgtcacctttcccctgttcgagaagatcgacgtcaacggc
gcccacgcgcaccctctgtatgagtacctgaaacgccagcaatccggcctgctgggcgcc
tccatcaaatggaatttcaccaaattcctcgtggaccgtgccggcaaggtgatcgcgcgc
tacgcgccgaccgcccgtcccgaaggattgcggcagcaaatcgagaccctgttatga

DBGET integrated database retrieval system