KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_26920Help
Entry
BJ6T_26920        CDS       T01848                                 

Definition
decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BJ6T_26920
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BJ6T_26920
Enzymes [BR:bju01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     BJ6T_26920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2773376..2774728)
Genome map
AA seq 450 aa AA seqDB search
MANAFFSDLLATISDRGRTLLRRGDSADTKHDAESLIELCGALLSGRGEASGTAMAREVL
DIYQELDAAGRRAFFEALVRDFGPDRERLSKAIEKWRARPSDEDASSLHFASEPRRQELI
RRLNRAPGGTGDLVNMRADLLGMMNGHTDLAALDRDVSHLLSSWFNRGFLVLRRIDWSTP
ANILEKIIRYEAVHEISDWDDLRRRIDPVDRRCYAFFHPAMVDEPLIFVEVALTETIPGA
IAPLLAVDRQHLPIERARTAVFYSISNTQRGLGGISFGSFLIKQVVEELRRETPKLDTFV
TLSPVPGFMQWVKQDKDLPLSDEDREILKRLDDPKWFENPETTTLLRTVIEPLAAYYFLK
ARTPKGKLIDSVARFHLGNGARLERINWLGDLSPKGARESAGVMVNYLYRLDDIEKNHEA
YANDGEVVASSAVKKLLKGEGRRLLDMRLS
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgccttcttctcagatctgctcgccaccatctccgatcgcggccgcacgctg
ctgcgccgcggggactccgccgacaccaagcacgatgccgaaagcctgatcgagctctgc
ggtgcgctgctgtccggtcgtggcgaagcttcgggcactgccatggcgcgtgaggtgctc
gacatctaccaggagttggatgcggcaggacgccgcgccttcttcgaagccctggtgcgt
gatttcggccccgatcgcgaacgcctgtccaaggcgatcgaaaaatggcgcgccaggcct
agtgacgaagacgcgagctcgctgcacttcgcctccgagccgcgccggcaggagctgatc
cgccgcctcaaccgcgcgccgggcggcaccggcgatctcgtcaacatgcgcgccgatctg
ctcggcatgatgaacggtcacaccgatctcgccgcgctcgatcgcgacgtctcgcatctt
ctctcgtcgtggttcaacagggggtttctcgtgctgcgccggattgactggtcgaccccg
gccaacatcctcgaaaagatcatccgttacgaagccgtgcacgagatcagcgactgggac
gacctgcgccgccgcatcgatccggtcgaccggcgctgctacgccttcttccatcccgcc
atggtcgacgagccgctgatcttcgtcgaggtggcgttgaccgagacgatccccggtgcg
atcgcgccgctgctggcggtcgatcgccagcatctgccgatcgagcgcgcgcgcaccgcg
gtgttctattcgatctcgaacacccagcgcgggcttggcggcatctccttcggcagcttc
ctgatcaagcaggtggtcgaagaactgcgccgcgagacgccgaaactcgacaccttcgtg
acgctgtcgccggtgccgggcttcatgcaatgggtgaagcaggacaaggacctgccgctg
tcggacgaggaccgcgagatcctgaagcgcctcgacgatcccaaatggttcgagaacccc
gagacgaccacgctgctccgcaccgtgatcgagccgctcgcggcctattacttcctgaag
gcgcgcacgccgaagggcaagctgatcgattccgtcgcccgcttccacctcggcaatggc
gcacggctcgagcgcatcaactggctcggcgacctctcgccgaaaggcgcgcgcgagtcc
gccggcgtgatggtcaactacctctaccgcctcgacgacatcgagaagaaccacgaagct
tacgccaatgacggcgaggtcgtggcgtcgagcgcggtgaagaagctgctcaagggcgag
ggacgcaggctgctggacatgcggttgtcgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system