KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_27000Help
Entry
BJ6T_27000        CDS       T01848                                 

Definition
methylamine utilization protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bju  Bradyrhizobium japonicum USDA 6
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2785357..2786700
Genome map
AA seq 447 aa AA seqDB search
MNSRTMWLLGAGLLCLAGALFAAGTQGLAETSQLGANPNPVRLMRPPVAPLSAMAQLGKE
IFYDASLSSSGALSCASCHSPDHAYGQPNDGPVMLGGAALSRQGARAVPSLTYLDRHPNF
SIGPDKGDDDNVIDLAQMAAIGQQAARTTKTAGGSGASANIVPQGGLFWDGRADTLQDQA
LFPLLDPNEMDGGSAEIVADKLRRAPYANRFVELFGAGVLRNQRLLIAEAMFAVARYQVE
EVSFHPYTSKYDYWLEGKARLSESELRGLQAFNDPDKANCAGCHTSAPTRDGLPPLFTDH
QYEALGAPRNAALAGNRDPNHFDLGVCGPQRTDIPEQTQYCGMFLTPTLRNTATRHAFFH
NGVFSTLEQVLDFYNFRDTNPEKVFPRGADGAVRKYDDLPQKYHANVDVTDPPFDRHPGD
KPAMTEQDEADIIAFLKTLTDGYKPEN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaacagccgcaccatgtggcttctcggcgccggcctgctttgtcttgccggcgccctc
tttgcggccgggacgcaaggacttgcggagacgagccagctcggagcgaacccgaatccg
gttcgcctcatgcgcccgcccgtcgcgccattgtccgcgatggcgcagctcggcaaggag
atcttctacgacgcgtcgctgtcgtcgtccggcgcgctgtcctgcgcgtcctgccacagc
ccggatcacgcctacggccagcccaacgacggaccggtgatgctcggcggcgccgccctg
tcgcggcaaggcgcacgcgcggtgccgtcgctgacctatctcgatcgccatcccaatttc
agcattggccccgacaagggcgacgacgacaatgtcatcgacctcgcgcagatggctgcg
atcggccagcaggccgcgcgcacgacgaagacggccggcggcagcggcgcatcggcgaac
atcgtgccgcaaggcggcctgttctgggacggccgcgcagacacgctgcaggaccaggcg
ctgttcccgctgctcgaccctaacgagatggacggcggcagtgccgagatcgtcgcggac
aagctgcgccgtgcgccttacgccaatcgcttcgtcgagctgttcggcgccggcgtgctc
agaaatcagcggctcctgatcgcggaggcgatgttcgcggtggcgcgctaccaggtggag
gaagtcagcttccatccttacaccagcaagtacgattactggctcgagggcaaggcgcgg
ttgtccgaaagcgagctgcgcggcctgcaagcgttcaacgaccccgacaaggccaattgc
gccggctgtcacacctcggcgccgacccgcgacggcctgccgccgctgttcaccgatcac
cagtacgaggcgctcggtgcgccgcgcaatgccgcgctcgccggcaatcgcgatcccaac
catttcgatctcggcgtctgcggcccgcagcgcaccgacattcccgagcagacgcaatac
tgcggcatgttcctgacgccgacgctgcgcaacacggcgacgcgccacgcgttcttccac
aacggcgtcttcagcaccctcgagcaggtcctggatttctacaattttcgcgacaccaat
ccggaaaaggtttttccgcgcggtgccgacggcgcggtgcggaaatacgacgacctgccg
caaaaatatcacgccaatgtcgatgtcaccgatccgccgttcgatcgccaccccggcgac
aagccggcgatgaccgagcaggacgaggccgacatcatcgcgtttctgaagacgctgacg
gacggctacaagccggagaactag

DBGET integrated database retrieval system