KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_29240Help
Entry
BJ6T_29240        CDS       T01848                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BJ6T_29240
   00670 One carbon pool by folate
    BJ6T_29240
Enzymes [BR:bju01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BJ6T_29240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3013988..3014497
Genome map
AA seq 169 aa AA seqDB search
MEIVFVVAIAENGVIGAGNAMPWRMKSDMARFKALTIGKPVIMGRKTFETLRRPLPNRTN
IVITRDADYRANGAIVTTSAADAGAVALGDALRRSVAEIAVIGGAEIYRQWLDRADRLEI
TEVHARPEGDTHFDIDKAEWDEVGRIRHPAGPDDSADYSYVTYRRRTGR
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggagatcgtcttcgtcgtcgcgatcgcggagaacggcgtcatcggcgcaggcaatgcg
atgccgtggcgaatgaaatccgacatggcgcgcttcaaggcgcttaccatcggcaagccc
gtgatcatgggtcgcaagaccttcgagaccctgcgccgcccgctgccgaaccgcaccaat
atcgtcatcacgcgcgatgcggattatcgcgccaacggcgccatcgtcacgacatcggct
gccgatgcgggcgcggttgcgcttggcgatgccctgcggcgttcggtcgccgagatcgcg
gtgatcggcggcgccgagatctatcggcaatggctcgatcgcgccgatcgcctcgaaatc
accgaagtccatgcgcgtcccgaaggcgacacgcatttcgacatcgacaaggcagagtgg
gatgaggttgggcgcatccgtcatcctgccggacccgacgacagcgccgactactcctat
gtgacatatcgtcggcggacgggccgttaa

DBGET integrated database retrieval system