KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_31360Help
Entry
BJ6T_31360        CDS       T01848                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bju00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3215088..3215813
Genome map
AA seq 241 aa AA seqDB search
MIPEGLRAVDLGDLPTDPATPQENRSLITSTTVSILKAGAVPLLLGGDDSVPIPFFAGFE
RFGPVTILQIDAHLDWRDDRDGLKHTFSSTMRRASEMPWVERIIQVGQRGIGGSRERDLA
DARAWGATLFSAATVRRHGVQPVIDLIPPGSHCIVTLDCDGLDPAVIPAVLVPQPGGLGY
LDIVELLHGVTQRARIVGFDLVELVPDADVRGLGVLAASRILCVALGCVARQRSAMRLAD
P
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
ttgatcccggaaggactgcgggcggttgatcttggcgaccttccaaccgatccggcaaca
ccgcaggagaatcgctcgctgatcacatcgacaaccgtgagcattctgaaggcgggcgcc
gtgcctctgctgctcggcggggatgactcggttcccattccattcttcgcggggttcgag
cggtttggccccgtcaccatcttgcaaatcgatgcgcatctcgactggcgtgatgatcgg
gatggcctcaagcatacattctccagcaccatgcgccgcgccagcgaaatgccatgggtg
gagcggatcattcaggttggacagcgcggcatcggtggttcgcgggaacgggatcttgcc
gacgcccgagcttggggcgcgacactgttcagtgcggcgaccgtgcgccgacacggcgtg
cagccggtcatcgacctaatcccgccgggcagccactgcatcgtcaccctcgattgcgac
gggctcgacccggctgttattcccgcggtgctggtcccacagccgggtggtctcggctat
ctcgatatcgtcgagcttttgcatggcgttacgcaacgggcgaggatcgttggttttgat
cttgtggagctggtgccggatgcggatgtacgaggcttaggcgtgctcgccgcctcgcgc
attctctgcgttgcccttggatgcgtggcgcgacagcgatccgctatgaggctagcggat
ccatga

DBGET integrated database retrieval system