KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_35810Help
Entry
BJ6T_35810        CDS       T01848                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BJ6T_35810
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BJ6T_35810
Enzymes [BR:bju01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BJ6T_35810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3671352..3672329
Genome map
AA seq 325 aa AA seqDB search
MTDRTMPDRARRIALLGAPIDMGASQRGTLMGPAALRTAGLAALLESLDFEVVDYGDLSV
AEVGDLADRPPEKANHYREIQRWTRLLSRRGHEIAQTGALPIFLGGDHTLSMGSVNAMAR
HWQERGRELFVLWLDAHADYNTPETTITANMHGMSAAFLCGEPGLDGLLGDDPRASIDPD
RLDLFGARSIDKLERELMRTRRIRVVDMRQIDEFGVAVLIRRVIERVKASDGVLHVSFDV
DFLDPCVAPGVGTTVPGGATYREAHLIMELLHDSGVVGSVDIVELNPFLDERGRTARTAV
ELIGSLFGQQITDRPTPSNAIAPGE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgatcggaccatgccggatcgagcccggcgcatcgccttgctcggcgcgcccatc
gacatgggagcttcgcagcgcggcaccttgatgggccctgcggcgctgcgcaccgccggg
cttgcggctttgctcgaaagccttgatttcgaagttgtcgactacggcgatctctccgtt
gcggaggtcggggacctcgctgaccggccgcccgaaaaagccaatcactatcgcgaaatc
cagcgctggacgcgtctgctgagccgcagaggccatgagatcgcgcagaccggggcgttg
ccgatcttcctcggtggcgatcacacattgtcgatgggctcggtgaatgccatggcgcgc
cactggcaggaacgcggacgcgagctgttcgtgctctggctcgacgcccatgccgattac
aacacgcccgagacgacgatcaccgccaacatgcacggcatgtcggcggcgttcttgtgt
ggcgagcccggcctcgacggattgctcggcgatgatccgcgcgcctcgattgatcccgac
aggctggacctgttcggcgcgcgttcgatcgacaagctcgaaagggaattgatgcgcaca
cgccggatcagggttgtcgacatgcgccagattgacgagttcggcgtcgctgtgctgatc
cggcgcgtcatcgagcgcgtcaaggcgagcgatggcgtgctccatgtcagcttcgatgtc
gatttcctcgatccgtgtgtggcgccgggagtcggcaccacggtgccgggcggagcgacc
tatcgcgaggcgcatctgatcatggagctgcttcatgattccggcgtggtcggatcggtc
gatatcgtcgagctcaatccgttcctggacgagcgcggtcgcaccgcgcgcactgcggtc
gagctgatcggcagcctgttcggacagcagatcaccgaccgcccgacgccgagtaacgcg
atcgcaccaggcgagtga

DBGET integrated database retrieval system