KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_36910Help
Entry
BJ6T_36910        CDS       T01848                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bju00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3782398..3784236
Genome map
AA seq 612 aa AA seqDB search
MCGIAGIVNLRGNAVEPSDISRLTRLIAHRGPFGEGIWFSPDRTLAFGHRRLAIIDPGEG
GYQPMLSADGRYVIVFNGEIYNFLELRRELEAQGAVFRSESDTEVILAAWEAWREDMLPR
FNGMWALAIFDTSTRELFLARDRFGIKPLLYAMSPERFVFASEQRALVRSGLIDPSVDLE
VARRLLLDAFGIEGSERTLFRQVRRLQAGHCMWLRQGKVSVRRWWRTVDHLPSVPTTESE
RVAGFRELFQDAVALRMRSDVPIGTCLSGGFDSSAVICTMASHEQAGMGPRDSTAWRHAF
VATFPGALNDERPMAEEAAAWAKVEPTFLEIGQADALTDLDRILDDLDDVYISLPSAVWL
IYRQLRQNDVTVSLDGHGADELMGAYLQEGQTFAFRIRNAAEDLASRSPLARRGVDFLRM
LALKRQGVYFLRGGLRDLPASLPLVAEDDVLPREWGGLNRRLYRMFHSTVLPTILRNFDR
LSMAHGIEVRMPFMDWRLVTYTMALPESSKSADGYTKAVARRAMANLMPESIRTARRKVG
FNSPMPEWLNGALAGWTADLLAREVPAFAELVDETALRRAVSRLTASKTWDWEAVGRIWP
YLNMKWMLARYA
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcgccggaatcgtcaatttgcgcggcaatgcggtcgagccgtccgacatc
tcgcgactgacccgcctgatcgcgcatcgtggtccgtttggcgaaggaatctggttcagc
ccggaccggactctcgcattcggccaccgtcgccttgcgatcatcgatcccggcgagggc
ggctatcagccgatgctgtctgcagacggccgttacgtcattgttttcaacggcgagatc
tacaattttctcgagctgcgccgcgagctcgaggcgcagggcgcggtgttccgtagcgaa
tccgataccgaagtgatcctggccgcctgggaagcctggcgggaagacatgctgccgcgc
ttcaacggcatgtgggccctggcgatcttcgatacgagcacgcgcgaattgttcctcgcg
cgcgatcgcttcggcatcaagccgctgctttatgccatgtcgccggagcgatttgtcttc
gcctccgagcagcgggcgctggtgcggagcggactgatcgatccctcggtcgatctggag
gtggcgcgccggctgttgctcgacgctttcgggatcgagggaagcgagcggaccttgttt
cggcaggttcgccgtctgcaggccggccattgcatgtggctgcgccagggcaaggtcagc
gtccggcgctggtggcggaccgtcgatcatttgccgtcggtgccgactacggaatccgag
cgcgtggccggcttccgcgagctgttccaggatgccgtggccctgcggatgcgcagcgat
gtgccgatcgggacgtgcttgtccggaggcttcgattcatcggcggtgatctgcaccatg
gcgtcgcacgagcaggccgggatggggccgcgcgacagcaccgcgtggcgccacgccttc
gtcgcgacgttcccgggtgcattgaatgacgagcggccgatggccgaggaggctgcagcc
tgggccaaggtcgagcccacgtttcttgaaatcgggcaggccgatgcgctgacggatctc
gaccggattcttgacgatctcgacgacgtctatatcagcctgcccagcgcggtatggctg
atctatcggcaattgaggcaaaacgacgtgacggtgtcgctcgacggccacggagcggac
gagttgatgggcgcctatttgcaggaaggacagacgtttgcgtttcggatccggaacgcg
gcagaagatctggcgtcgcgatcgccgctggcgcgtcgcggcgtggacttcctgcgcatg
ttggccctgaagcgtcagggggtctattttctgcgtggcggcctgcgcgatcttccggcc
tcgttgccgctggtcgcggaggatgatgtgctgccgcgtgaatggggcggcctgaaccgc
cgcctctaccgcatgtttcacagcacggtgctgcccacaatcctgcgcaacttcgatcgt
ctctcgatggcccacggcatcgaggtccgcatgcccttcatggactggcgcctggtgacc
tacacgatggcgcttcccgaaagcagcaagtcggcggatggctacaccaaggcggtcgcc
cggcgcgcgatggcgaacctgatgccggagtcgatccgcacggcgcgccgcaaggtcggc
ttcaattcgccgatgcccgaatggctgaacggagccttggccggctggacggcagatctg
ctcgctcgcgaggtgccggcgtttgccgaactggtcgatgaaacggccttgcgccgggcg
gtcagccgcttgacggcgtcgaagacgtgggactgggaggcggtcggacggatctggccg
tatctgaacatgaaatggatgttggcaaggtacgcgtaa

DBGET integrated database retrieval system