KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_40780Help
Entry
BJ6T_40780        CDS       T01848                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BJ6T_40780
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BJ6T_40780
  Lipid metabolism
   00071 Fatty acid degradation
    BJ6T_40780
  Amino acid metabolism
   00350 Tyrosine metabolism
    BJ6T_40780
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BJ6T_40780
   00626 Naphthalene degradation
    BJ6T_40780
Enzymes [BR:bju01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BJ6T_40780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4200901..4201926
Genome map
AA seq 341 aa AA seqDB search
MPTMKAAVVKQFGKPLVIEDVAVPQPGPGEVLVEVKACGVCHTDLHAASGDWPVKPTPPF
IPGHEAAGIVAALGPGVKNLKVGDAVGVAWLHDACMACEYCETGWETLCEHQHNTGYSVN
GGFAEYVIASAVFAAKLPPTVDFAAIAPILCAGVTTYKGLKETDARPGEWVAISGVGGLG
HVAIQYAKAMGFKVAAIDIAEDKLALARETGADLAVNALAADAVNEVLTATGGGAHGVLV
TAVSTAAFAQALEIVRRKGTVSLVGLPPGEFPTPIFDVVLKRITVRGSIVGTRRDLAEAV
AFATEGKVKAEVTKVPLAQINDVFERMKAGKIDGRMVLDFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccatgaaggccgcagtcgtcaagcaattcggcaagccgctggtgatcgaggac
gtggcggtgccgcagcccggtcccggcgaggttttggtcgaggtgaaagcgtgcggcgtc
tgccacaccgatctgcacgccgcttccggcgactggccggtgaagccgacgccgcctttc
attcccggccatgaagccgcaggtatcgtcgccgcgctcggccctggcgtgaaaaacctg
aaggttggcgatgctgtcggcgtcgcctggctgcatgacgcctgtatggcctgcgaatat
tgcgagaccggctgggagacgctgtgcgagcaccagcacaacaccggctacagcgtgaac
ggcggctttgcagaatatgtcatcgcctcggctgtctttgccgcaaagctgccgcccacc
gtcgatttcgcggcaatcgcgccgatcctgtgcgccggcgtcaccacctacaagggattg
aaggaaaccgacgcgcggcccggcgaatgggtggcgatctcaggcgtcggcgggctcggc
catgtcgcgatccaatacgccaaggcgatgggcttcaaggtcgcggcgatcgatatcgcc
gaggacaagcttgcgctcgcgcgcgagaccggcgccgatctcgcggtcaacgcgctcgcc
gctgatgccgtaaatgaggtccttacggcgaccggaggcggggcgcacggcgtactggtg
acggcggtctcgaccgcggcatttgcgcaggctctagagatagtgcgccggaagggcacg
gtcagcctcgtcggcctgccgccgggtgaattcccgacgccgatcttcgacgtcgtgctc
aagcgtatcaccgtgcgcggctccatcgtaggcacccgccgggatctcgccgaagctgtc
gcattcgccaccgagggcaaggtcaaggccgaggtgacgaaggtgccgctggcgcaaatc
aacgacgtcttcgagcggatgaaggccggcaagatcgatggccgcatggtgctggacttt
ggctag

DBGET integrated database retrieval system