KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_42280Help
Entry
BJ6T_42280        CDS       T01848                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00790  Folate biosynthesis
bju01100  Metabolic pathways
Module
bju_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BJ6T_42280
Enzymes [BR:bju01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BJ6T_42280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF EIF_2_alpha
Motif
Other DBs
NCBI-ProteinID: BAL09501
UniProt: G7D3L9
Position
4347447..4348139
Genome map
AA seq 230 aa AA seqDB search
MDAAIKSIRPGKPSDRQPESRLAELDPAEFLAAAVRADQPRPARAEAEAAVKTLLAYIGE
NTAREGLLDTPRRVVEAFDELYQGYHQCPAEVLDRTFGETAGYDDFVLVRDIEFTSQCEH
HMMPFYGKAHIAYTPVERVVGLSKLARLTDIFARRLQTQEHMTAQIAAAIDEILKPRGVA
VLIEAEHTCMSVRGVAKHGASTFTSRFTGMFRDNPAEQARFLSLVRGTPR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggacgctgcgatcaaatccatccgcccgggcaagccctccgaccgccagcccgagagc
cgcctggctgagctcgaccctgccgaattcctcgcggccgccgtccgcgccgaccagccg
cgccccgcgcgcgcagaggcggaagcggcggtgaagacgctgctcgcctatatcggcgag
aacaccgcgcgcgaaggcttgctcgacacgccgcgccgtgtggtcgaggccttcgacgag
ctctatcagggctaccaccagtgcccggccgaggtgctcgaccgcacgttcggcgagacg
gccggctatgacgacttcgtgctggtgcgcgacatcgagttcacctcgcagtgcgagcat
cacatgatgccgttctacggcaaggcgcacatcgcctatacgccggtggaacgcgtcgtc
ggcctgtcgaagcttgcgcgcctgaccgacatcttcgcccgcaggctccagacccaggag
cacatgacggcgcagatcgcggcggccatcgacgagatcctcaagccccgcggcgtggcc
gtgctgatcgaggccgagcatacctgcatgtcggtgcgcggcgttgccaagcatggtgcc
tcgaccttcaccagccgcttcactggcatgttccgcgacaatccggcggagcaagcccgc
ttcctgtccctggtgcgaggcacgccgcgctga

DBGET integrated database retrieval system