KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_42280Help
Entry
BJ6T_42280        CDS       T01848                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bju00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4347447..4348139
Genome map
AA seq 230 aa AA seqDB search
MDAAIKSIRPGKPSDRQPESRLAELDPAEFLAAAVRADQPRPARAEAEAAVKTLLAYIGE
NTAREGLLDTPRRVVEAFDELYQGYHQCPAEVLDRTFGETAGYDDFVLVRDIEFTSQCEH
HMMPFYGKAHIAYTPVERVVGLSKLARLTDIFARRLQTQEHMTAQIAAAIDEILKPRGVA
VLIEAEHTCMSVRGVAKHGASTFTSRFTGMFRDNPAEQARFLSLVRGTPR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggacgctgcgatcaaatccatccgcccgggcaagccctccgaccgccagcccgagagc
cgcctggctgagctcgaccctgccgaattcctcgcggccgccgtccgcgccgaccagccg
cgccccgcgcgcgcagaggcggaagcggcggtgaagacgctgctcgcctatatcggcgag
aacaccgcgcgcgaaggcttgctcgacacgccgcgccgtgtggtcgaggccttcgacgag
ctctatcagggctaccaccagtgcccggccgaggtgctcgaccgcacgttcggcgagacg
gccggctatgacgacttcgtgctggtgcgcgacatcgagttcacctcgcagtgcgagcat
cacatgatgccgttctacggcaaggcgcacatcgcctatacgccggtggaacgcgtcgtc
ggcctgtcgaagcttgcgcgcctgaccgacatcttcgcccgcaggctccagacccaggag
cacatgacggcgcagatcgcggcggccatcgacgagatcctcaagccccgcggcgtggcc
gtgctgatcgaggccgagcatacctgcatgtcggtgcgcggcgttgccaagcatggtgcc
tcgaccttcaccagccgcttcactggcatgttccgcgacaatccggcggagcaagcccgc
ttcctgtccctggtgcgaggcacgccgcgctga

DBGET integrated database retrieval system