KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_44370Help
Entry
BJ6T_44370        CDS       T01848                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bju  Bradyrhizobium japonicum USDA 6
Brite
Enzymes [BR:bju01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BJ6T_44370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4526394..4527122
Genome map
AA seq 242 aa AA seqDB search
MKALLLVIAMIVLARDASAQDAQCVRERAAMVETIRTYARSAAGVLGRQGLSERVLEAMA
QTLRHLFIPERSCSVAYADQPIPIGLGQTISQPYVVALMTQLAEVAPDHVVLEVGTGSGY
QAAILARLAQKVCTIEIIPQLAETAAKTLRDLAYDNASVRLGDGYNGWPECGPFDAIVVT
AALGEPPPPLIEQLKVGGRLVMPVGPAYTTQQLTVVEKIAPGKTTTRAVALVRFVPFTRS
QN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccttgctgctcgtgattgccatgattgtcctcgcgcgggacgcgagcgcgcag
gacgcgcaatgcgtccgcgaacgcgccgccatggttgaaaccatccggacctacgcccgg
tccgccgccggtgttctcggacggcaaggcctgtcggagagggtccttgaggccatggcg
caaacgttgcgccatctgttcatccccgagcgatcatgctctgtcgcgtacgcggatcaa
ccgataccgattggcctcggccagaccatatcgcagccctatgtcgtcgccttgatgacc
cagctggccgaggtcgcgcccgatcatgttgtgctcgaagtcggtacgggttcgggctac
caggcagccattcttgcgcgtctggcgcaaaaggtctgtaccatcgagattatcccgcaa
ctggccgagaccgccgcgaagacactacgagacctcgcatatgacaacgcgagtgtcagg
ctcggcgacggctacaatggctggcccgaatgcggtccttttgacgccatcgtcgtgact
gcggcgctcggggaaccaccgccaccgctgatcgagcagctgaaggtgggaggccggctc
gtcatgccagtaggaccggcttacacgactcagcagctcacggtcgtcgagaaaattgcc
cccggcaagacgacgactcgcgcggttgccctcgtgcgctttgtcccgtttacgcgctcg
caaaactag

DBGET integrated database retrieval system