KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_46190Help
Entry
BJ6T_46190        CDS       T01848                                 

Definition
(GenBank) aspartate carbamoyl transferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00240  Pyrimidine metabolism
bju00250  Alanine, aspartate and glutamate metabolism
bju01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BJ6T_46190
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BJ6T_46190
Enzymes [BR:bju01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BJ6T_46190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: BAL09886
UniProt: G7D6K0
Position
complement(4695751..4696698)
Genome map
AA seq 315 aa AA seqDB search
MTSKSTFVLGHRHLLGIEGLSAADITGLLDLSEEYVELNRQVDKKRTVLRGRTQVNLFFE
ASTRTQSSFELAGKRLGADVMNMSVSSSSIKKGETLVDTAMTLNAMHPDILVVRHHASGA
VELLARKVDGSVINAGDGAHEHPTQALLDALTIRRNKGRIEGLVVAICGDVLHSRVARSN
IILLNTMGARVRVVGPSTLLPPGIERMGVEVARDMREGLNGADIVMMLRLQRERMNGSFV
PSTSEYFNYFGLDQKKLAYAKPDALVMHPGPMNRGVEIDTAVADGAQSLIREQVEMGVAV
RMAVLEALARNLPNA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgaaatcgaccttcgtcctcggccaccggcatttgctgggcatcgagggcctt
tccgcggccgacatcaccggcctcctcgacctgtccgaagaatatgtcgagctcaaccgc
caggttgacaagaagcgcaccgtcctgcgtggacggacgcaggtgaacctcttcttcgag
gcctccacccgaacccagtcctcgttcgagctcgccggcaaaaggctgggcgccgacgtc
atgaacatgtcggtctcctcctcgtccatcaagaagggcgagacgctggtcgacaccgcg
atgacgctgaacgccatgcatccggatatcctggtggtgcgccatcacgcgtccggcgcg
gtggaactgctggcgcgcaaggtcgacggttccgtgatcaatgccggcgacggcgcgcac
gagcatccgacgcaggcgctgctcgacgccctgaccattcgccgcaacaagggccggatc
gagggcctcgtggtcgcgatctgcggcgacgtgctgcattcgcgtgttgcccgttccaac
atcatcctgctcaacaccatgggcgcccgcgtccgcgtcgtcggcccttccacgctgctg
ccgcccggcatcgagcggatgggggtcgaggttgcgcgcgacatgcgcgaggggctcaac
ggcgccgatatcgtcatgatgctgcggctccagcgcgagcgaatgaacggctccttcgtg
ccgtcgacctccgaatatttcaactatttcgggctggaccagaaaaagctcgcttacgcc
aagccggacgctctcgtcatgcatcccggcccgatgaaccgcggcgtcgagatcgacacc
gcggtcgccgatggcgcgcaatcgctgatccgcgaacaggtcgagatgggcgtggcggta
cggatggccgtgctcgaagcgctcgcccgcaacttgccgaacgcgtga

DBGET integrated database retrieval system