KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_46190Help
Entry
BJ6T_46190        CDS       T01848                                 

Definition
aspartate carbamoyl transferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bju00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bju00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4695751..4696698)
Genome map
AA seq 315 aa AA seqDB search
MTSKSTFVLGHRHLLGIEGLSAADITGLLDLSEEYVELNRQVDKKRTVLRGRTQVNLFFE
ASTRTQSSFELAGKRLGADVMNMSVSSSSIKKGETLVDTAMTLNAMHPDILVVRHHASGA
VELLARKVDGSVINAGDGAHEHPTQALLDALTIRRNKGRIEGLVVAICGDVLHSRVARSN
IILLNTMGARVRVVGPSTLLPPGIERMGVEVARDMREGLNGADIVMMLRLQRERMNGSFV
PSTSEYFNYFGLDQKKLAYAKPDALVMHPGPMNRGVEIDTAVADGAQSLIREQVEMGVAV
RMAVLEALARNLPNA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgaaatcgaccttcgtcctcggccaccggcatttgctgggcatcgagggcctt
tccgcggccgacatcaccggcctcctcgacctgtccgaagaatatgtcgagctcaaccgc
caggttgacaagaagcgcaccgtcctgcgtggacggacgcaggtgaacctcttcttcgag
gcctccacccgaacccagtcctcgttcgagctcgccggcaaaaggctgggcgccgacgtc
atgaacatgtcggtctcctcctcgtccatcaagaagggcgagacgctggtcgacaccgcg
atgacgctgaacgccatgcatccggatatcctggtggtgcgccatcacgcgtccggcgcg
gtggaactgctggcgcgcaaggtcgacggttccgtgatcaatgccggcgacggcgcgcac
gagcatccgacgcaggcgctgctcgacgccctgaccattcgccgcaacaagggccggatc
gagggcctcgtggtcgcgatctgcggcgacgtgctgcattcgcgtgttgcccgttccaac
atcatcctgctcaacaccatgggcgcccgcgtccgcgtcgtcggcccttccacgctgctg
ccgcccggcatcgagcggatgggggtcgaggttgcgcgcgacatgcgcgaggggctcaac
ggcgccgatatcgtcatgatgctgcggctccagcgcgagcgaatgaacggctccttcgtg
ccgtcgacctccgaatatttcaactatttcgggctggaccagaaaaagctcgcttacgcc
aagccggacgctctcgtcatgcatcccggcccgatgaaccgcggcgtcgagatcgacacc
gcggtcgccgatggcgcgcaatcgctgatccgcgaacaggtcgagatgggcgtggcggta
cggatggccgtgctcgaagcgctcgcccgcaacttgccgaacgcgtga

DBGET integrated database retrieval system