KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_46720Help
Entry
BJ6T_46720        CDS       T01848                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bju00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4747913..4748974)
Genome map
AA seq 353 aa AA seqDB search
MAIKYGRPIELREVSRRDGAAASPALDLTVRPRRNRKAEWARRMVRENVLTTDDLIWPLF
LIDGNNKREQIASMPGVDRLSVDQAVREAERAMKLTIPCLALFPYTDPSLRDEEGSEATN
PNNLVCQAVRAIKKEFPDIGILCDVALDPFTSHGHDGLISDGKILNDETVAVLVRQALVQ
AEAGCDIIAPSDMMDGRVAAIREGLDRSSLLDVQIMAYAAKYASAFYGPFRDAIGSAKTL
TGDKRTYQMDSANTDEALREVDLDISEGADMVMVKPGMPYLDVVRRVKDTFAMPTFAYQV
SGEYAMIAAAANNGWLDGERAMMESLLAFKRAGADGVLSYFAPKVAEKLRSQT
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcaaatacggacgtccgatcgaattgcgcgaggtttcgcgccgggatggcgct
gccgcctcccctgccctcgatctgaccgtccgcccgcgccgtaaccgcaaggccgaatgg
gcccggcgcatggtgcgcgagaacgtgctcaccaccgacgatttgatctggccgctgttc
ctgatcgacggcaacaacaagcgcgagcagatcgcctcgatgccgggcgtcgaccgcctc
agcgtcgaccaggctgtgcgcgaggccgagcgcgccatgaagctcaccatcccctgcctc
gcgctgtttccctataccgacccgtccctgcgcgatgaggaaggctccgaggcgaccaat
ccgaacaacctggtctgccaggcggtgcgcgcgatcaagaaagagtttcccgacatcggc
atcctctgcgacgtcgccctcgatcccttcaccagccacggccatgacggcctgatctct
gacggcaagatcctgaatgacgagacggtcgcggtgctggtgcgtcaggcgctggtccag
gccgaagccggctgcgacatcatcgcgccgtccgacatgatggacggccgcgtcgccgcg
atccgcgaggggctggatcgctccagcctgctcgacgtgcagatcatggcctatgcggca
aagtacgcctccgccttctacggcccgttccgcgacgccatcggttcggccaagacgctg
accggcgacaagcgcacttaccagatggacagcgccaacaccgacgaggcgctgcgcgag
gtcgatctcgacatctccgagggcgccgacatggtgatggtgaaacccggcatgccctat
ctcgacgtggtccggcgcgtgaaggacacctttgcgatgccgaccttcgcctaccaggtc
tccggcgaatacgcgatgatcgcagccgccgccaacaacggctggctcgacggcgagcgc
gcgatgatggaaagcctgctggcgttcaagcgcgccggcgccgacggcgtgctcagctat
tttgcgccgaaggtggccgagaagctgcggagccaaacgtaa

DBGET integrated database retrieval system