KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_49010Help
Entry
BJ6T_49010        CDS       T01848                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BJ6T_49010
   01230 Biosynthesis of amino acids
    BJ6T_49010
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BJ6T_49010
   00051 Fructose and mannose metabolism
    BJ6T_49010
   00562 Inositol phosphate metabolism
    BJ6T_49010
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BJ6T_49010
Enzymes [BR:bju01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BJ6T_49010
Exosome [BR:bju04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BJ6T_49010
  Exosomal proteins of bladder cancer cells
   BJ6T_49010
  Exosomal proteins of melanoma cells
   BJ6T_49010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4980210..4980965
Genome map
AA seq 251 aa AA seqDB search
MTDANRPLIAGNWKMNGLKGSAAEFDAMLKGAAEVAAKADLLVCPPATLITAFADKARGS
KVAVGAQDCHPKASGAHTGDIAAEMLADAGATAIIVGHSERRADHGEGDALIRQKAEAAW
RAGVTAIVCVGETQGQRDAGQTLDILRGQLDGSLPDGSTAANLVVAYEPVWAIGTGLTPT
AQDVEQIHSFIRELLTSRFRADGARMRILYGGSVKPSNAAELMSVKNVNGALVGGASLKA
ADFLAIAKGCP
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgccaaccgaccgctgatcgccggcaattggaaaatgaacggcctcaagggc
tcggctgccgaattcgacgccatgctcaagggggcggcagaggtggccgccaaggccgac
ctgctggtctgcccgccggcgaccctaatcacggccttcgccgacaaggcgcgcggcagc
aaggtcgcggtgggggcgcaggattgccatcccaaggcctccggcgcccataccggcgat
atcgccgccgaaatgctggccgatgccggtgcgaccgccatcatcgtcggtcattccgag
cgtcgcgccgaccacggcgagggcgatgccctgatccggcagaaggccgaggccgcctgg
cgcgccggcgtcaccgcgatcgtctgcgtcggtgagacgcaaggccagcgcgatgccggc
cagaccctcgacatcctgcgcggccagctcgacgggtcgctgccggacggctcgaccgcc
gccaacctggtcgtggcctatgagccggtctgggcgatcggcaccggcctgaccccgacg
gcccaggatgttgagcagattcatagctttatccgggaacttctgacctcccggttcagg
gcggacggggccaggatgcgcatcctctatggcggctcggtcaagccgtcgaacgcggcc
gagctgatgtccgtgaaaaacgtcaacggcgcgctggtcggcggcgccagcctgaaggcg
gccgatttccttgcgattgcgaagggctgcccctag

DBGET integrated database retrieval system