KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_49640Help
Entry
BJ6T_49640        CDS       T01848                                 

Definition
glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bju00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bju00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5049120..5050148
Genome map
AA seq 342 aa AA seqDB search
MSTRAFITGVSGTELTAVEREFIRAERPWGFILFRRNVDTPAQVAALVAELRAVAGAADA
PVLIDQEGGRVQRLGPPHWPVYPPGAIFSTLYDTDSVLGLTAARLSARLIASDLADLGIT
VDCLPLADVPVPGADAVIGNRAYGTEPGKVAAIARAVTEGLEQGGVLPVLKHIPGHGRAT
ADTHFKLPTVDAPRDELDRTDFAAFQPLADLPMAMTAHVVFSAVDPAHPATTSATMITQV
IRGVIGFQGLLMSDDVSMNALSGNIAERTRAIFAAGCDMALHCNGNIEEMREVAGQTPEL
SGTALARAKAALASRKAPQPFDRAAARAELDALIARANTASA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcgggccttcattaccggtgtatccggaacggaactaaccgccgtcgagcgg
gagtttatccgtgccgaacgcccatggggcttcatcctcttcaggcgcaatgtcgatacg
ccggctcaagttgctgcgctggttgcggaattgcgggcggttgcgggtgcggctgacgcg
cctgtcctgatcgaccaggagggggggcgggtgcagcggctgggcccaccgcactggccg
gtctatccgccgggcgccattttctcgaccttgtacgacactgattcggtacttggactg
acggctgcgcgcctcagcgcccggctgattgcgtctgatcttgccgatctcggcattacc
gtggattgcctgccgctggctgacgtgccggtgccgggtgccgatgccgtcattgggaac
agggcttacggcactgagccgggcaaggtcgccgcgatcgcgcgcgcggtcaccgagggc
ctggagcagggcggcgtgctgccggttctcaagcacattcccggccatggacgcgccacc
gccgacacccatttcaagctgccgacggtcgatgctccgagggacgaactcgaccggacc
gactttgcggcattccagccgttggccgacctgccgatggccatgactgcacatgttgtg
tttagcgcggtcgaccccgcccatccggcgacgacttctgcgacaatgatcactcaggtg
attcgcggcgtgatcgggttccagggtttgttaatgagtgatgacgtgtcgatgaacgcg
ctgtcggggaatatcgccgaacggacccgcgccatcttcgcggccggctgcgacatggcc
ttgcattgcaacggcaacatcgaggagatgcgcgaggtcgccggccagacacctgagctg
tccggcacggcgctggcgcgggcgaaggccgcactagcgtcgcgcaaggcaccgcagccg
ttcgaccgggcggccgcacgcgccgaactggacgcattgatcgcacgggcaaacacggca
tccgcatga

DBGET integrated database retrieval system