KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_49740Help
Entry
BJ6T_49740        CDS       T01848                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bju  Bradyrhizobium japonicum USDA 6
Brite
Enzymes [BR:bju01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BJ6T_49740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5057163..5057813
Genome map
AA seq 216 aa AA seqDB search
MTSDQHPPEKMMFQLSLRRRGISDQAVLRTMEEVPRDLFVEEADRDAAYRDSALPIACGQ
TISQPFVVAYMTEQLQLQKKHRVLEIGAGSGYQAAVLSRLAGQVLTVERYRKLAEAARAR
LEKLGCHNVEVMLGDGLNLPANIGPFDRIIVTAAMEQLPENLVERLEVGGILIAPIGPHH
GVQTLVRFSRTEAGIERKELVEVRFVPALPGVAREL
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgacctccgatcagcacccgccggaaaagatgatgtttcagctctcgctgaggcgccgc
ggcatcagcgatcaggcggtgctgcgaaccatggaggaggtgccgcgcgatctgttcgtc
gaggaggccgatcgcgacgccgcctatcgtgacagcgcgctgccgatcgcctgcgggcag
accatcagccagcccttcgtcgtcgcctacatgaccgagcaactgcagctccagaagaag
caccgcgtgctcgagatcggcgccggctcgggctatcaggccgccgtgctgtcgcgtctc
gcgggccaggtgctgaccgtcgagcgctaccgcaagctcgcggaggcggcacgcgcccgg
ctcgaaaagctcggctgtcacaatgtcgaggtgatgctcggcgacggcctcaacctgccg
gccaatatcggcccgttcgaccgcatcatcgtgaccgccgcgatggagcagcttccggag
aacctggtcgagcggctggaggtcggcggcatcctgatcgcgcccatcggcccgcaccat
ggtgtgcagacgctggtccgcttcagccggaccgaagccgggatcgagcgcaaggaactc
gtcgaggtccgcttcgtgccggcgctgcccggggtggcgcgggagctgtag

DBGET integrated database retrieval system