KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_51340Help
Entry
BJ6T_51340        CDS       T01848                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00010  Glycolysis / Gluconeogenesis
bju00052  Galactose metabolism
bju00500  Starch and sucrose metabolism
bju00520  Amino sugar and nucleotide sugar metabolism
bju00521  Streptomycin biosynthesis
bju01100  Metabolic pathways
bju01110  Biosynthesis of secondary metabolites
bju01120  Microbial metabolism in diverse environments
bju01130  Biosynthesis of antibiotics
bju01200  Carbon metabolism
Module
bju_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BJ6T_51340
   00052 Galactose metabolism
    BJ6T_51340
   00500 Starch and sucrose metabolism
    BJ6T_51340
   00520 Amino sugar and nucleotide sugar metabolism
    BJ6T_51340
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BJ6T_51340
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BJ6T_51340
Enzymes [BR:bju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BJ6T_51340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: BAL10395
UniProt: G7DAS7
Position
complement(5216237..5217223)
Genome map
AA seq 328 aa AA seqDB search
MSIGKTGQILLADIGGTNARFALSESGSDSGDQAGPIDYVKVADFPTVREAIADVLARRS
GGKQPKRAVLAVAGPVTNNRCVMTNSPWVIDGNELQPALGFESVHVLNDFEVVAWSLPAL
KPADLIPLGGQDGLPGEPLLVVGPGTGFGVSCLVERHGARLAVVTEAGHATLPAENEREE
RVIACLRRRFGHVSIERGALSGSGLQSLYEALAEVDGAQVPHRDAAAITKAALEGSCELS
RATLEMFCAILGSVAGNLAVTFGARGGVYIAGGIVPRFPEFLAASAFRARFEAKGRFQDY
LRNIPTRLVTKPDASFVGLKMFADHNPD
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcggcaagacaggacaaattcttctcgccgatatcggcggcaccaatgcgcgc
tttgcgctgagcgaaagcggatcggacagcggcgaccaggccgggcccatcgactatgtg
aaggtcgctgacttcccgaccgtccgggaagccatcgccgacgtccttgcgcgccggtcc
ggcggcaagcagcccaaacgagccgtgctggccgtcgcgggtcccgtgaccaacaaccgc
tgcgtcatgaccaacagtccgtgggtcattgacggcaacgagctccagcccgccctcggc
ttcgagagcgtgcatgtgctcaatgatttcgaggtcgtggcctggtccctgcccgccctg
aagcctgccgatctgatcccgctcgggggccaggacggcctccccggagagccgctgctg
gtggttgggcctggaaccggctttggcgtctcctgtctggtcgaacgccacggcgcccgg
ctggcggtcgtcaccgaggcaggccacgccactttgccggcggaaaacgagcgcgaggaa
cgcgtgatcgcttgcttgcgccgacgtttcggccatgtctccatcgagcgcggcgcgctt
tcgggctccggtctgcagagcctctatgaggcgctggcggaggtcgacggcgcccaggtg
ccgcaccgcgacgccgccgccatcaccaaggcagccctggagggcagttgcgaactcagc
cgcgcgacgctggagatgttttgcgccatcctcggctcggtcgcaggcaatctcgcggtg
accttcggcgcccgcggcggcgtctacatcgccggcgggatcgtgccgcgcttccccgag
ttcctcgcggcctccgctttccgtgcgcgcttcgaagccaagggacgcttccaggactat
ttgcgcaacatcccgaccaggctggtgacgaaaccggacgcgagcttcgtcgggttgaag
atgttcgccgaccacaatccggattga

DBGET integrated database retrieval system