KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_51340Help
Entry
BJ6T_51340        CDS       T01848                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BJ6T_51340
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BJ6T_51340
   00052 Galactose metabolism
    BJ6T_51340
   00500 Starch and sucrose metabolism
    BJ6T_51340
   00520 Amino sugar and nucleotide sugar metabolism
    BJ6T_51340
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BJ6T_51340
   00524 Butirosin and neomycin biosynthesis
    BJ6T_51340
Enzymes [BR:bju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BJ6T_51340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5216237..5217223)
Genome map
AA seq 328 aa AA seqDB search
MSIGKTGQILLADIGGTNARFALSESGSDSGDQAGPIDYVKVADFPTVREAIADVLARRS
GGKQPKRAVLAVAGPVTNNRCVMTNSPWVIDGNELQPALGFESVHVLNDFEVVAWSLPAL
KPADLIPLGGQDGLPGEPLLVVGPGTGFGVSCLVERHGARLAVVTEAGHATLPAENEREE
RVIACLRRRFGHVSIERGALSGSGLQSLYEALAEVDGAQVPHRDAAAITKAALEGSCELS
RATLEMFCAILGSVAGNLAVTFGARGGVYIAGGIVPRFPEFLAASAFRARFEAKGRFQDY
LRNIPTRLVTKPDASFVGLKMFADHNPD
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcggcaagacaggacaaattcttctcgccgatatcggcggcaccaatgcgcgc
tttgcgctgagcgaaagcggatcggacagcggcgaccaggccgggcccatcgactatgtg
aaggtcgctgacttcccgaccgtccgggaagccatcgccgacgtccttgcgcgccggtcc
ggcggcaagcagcccaaacgagccgtgctggccgtcgcgggtcccgtgaccaacaaccgc
tgcgtcatgaccaacagtccgtgggtcattgacggcaacgagctccagcccgccctcggc
ttcgagagcgtgcatgtgctcaatgatttcgaggtcgtggcctggtccctgcccgccctg
aagcctgccgatctgatcccgctcgggggccaggacggcctccccggagagccgctgctg
gtggttgggcctggaaccggctttggcgtctcctgtctggtcgaacgccacggcgcccgg
ctggcggtcgtcaccgaggcaggccacgccactttgccggcggaaaacgagcgcgaggaa
cgcgtgatcgcttgcttgcgccgacgtttcggccatgtctccatcgagcgcggcgcgctt
tcgggctccggtctgcagagcctctatgaggcgctggcggaggtcgacggcgcccaggtg
ccgcaccgcgacgccgccgccatcaccaaggcagccctggagggcagttgcgaactcagc
cgcgcgacgctggagatgttttgcgccatcctcggctcggtcgcaggcaatctcgcggtg
accttcggcgcccgcggcggcgtctacatcgccggcgggatcgtgccgcgcttccccgag
ttcctcgcggcctccgctttccgtgcgcgcttcgaagccaagggacgcttccaggactat
ttgcgcaacatcccgaccaggctggtgacgaaaccggacgcgagcttcgtcgggttgaag
atgttcgccgaccacaatccggattga

DBGET integrated database retrieval system