KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_51350Help
Entry
BJ6T_51350        CDS       T01848                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BJ6T_51350
Enzymes [BR:bju01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     BJ6T_51350
    3.5.1.-  
     BJ6T_51350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5217427..5218107
Genome map
AA seq 226 aa AA seqDB search
MDGAFGARRAGRLERDLAMQISDRDVLLVIDVQNDFCTGGALAVPGGEKVVPAINRIAAN
FTNVVLTQDWHPGDHVSFAPNHAGKQPFQTIELDYGTQVLWPSHCVQGTVGAEFHGELEI
SRANLVVRKGFRRGIDSYSALFENDHRTPTGLLGYLRERELKTVFVAGLALDFCVRFSAE
DARKAGFEVAVIEDACRGIDLDGSVVATHRSFRERGISIVSLEALL
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
ttggacggagcgttcggcgcccgtcgcgccggacggctggaacgggaccttgcgatgcag
atttccgaccgcgatgtgctgctggtgatcgacgtgcagaacgacttttgcaccggcgga
gcgctcgccgttcccggcggcgagaaggttgtcccggcgatcaaccgaattgccgcaaat
ttcaccaatgtggtgctgacccaggactggcatccaggcgaccacgtctcgttcgcaccg
aaccatgcgggcaagcagccgttccagacgattgagctcgactacggcacccaggtgctg
tggccgtcgcactgcgtgcaaggcacggtgggcgctgaattccatggtgagctcgaaatt
tccagggcaaacctcgtcgtgcgcaaaggttttcgtcgcggcatcgattcctattcggcg
ctgttcgagaacgaccaccggacgccgacgggcctgctcggctatttgcgcgagcgcgag
ctgaagaccgtcttcgtcgccggtctggcgctggatttctgtgttcgcttctcggcggaa
gatgcccgcaaggcggggttcgaggtcgccgtcatcgaggacgcatgccgcggcatcgat
ctcgacggctctgtggtcgcgacccatcggagttttcgcgagcgcggtatttcgatcgtc
agcctggaggccttgctgtga

DBGET integrated database retrieval system