KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_54710Help
Entry
BJ6T_54710        CDS       T01848                                 

Definition
hypothetical protein
Orthology
K13590  
diguanylate cyclase
Organism
bju  Bradyrhizobium japonicum USDA 6
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5542270..5543337
Genome map
AA seq 355 aa AA seqDB search
MVKVLDEHERTMAFAEVALGQIRSLRQTAIPRNYEIWYVYATGYNAPLNKIINETLARHG
KLTEGDLEQIYETYLSHIKTTDRIDKVGARVIGEIDDVMTVLSEALGMTGSYDASLSGAT
EQLSSAKNRDQIKSIVETLLRSTGEMRETNKALEDRLTLSKNEISNLQQSLEAIRAESLT
DPLTGLGNRKYFDRMIGMAVQSALASGEPLSLLLFDIDHFKSFNDSYGHLTGDQVLRLVG
LSMKQTIKGQDITARYGGEEFAVLLPNTALRQALTVADHIRRAVMAKELKKKSTGEILGR
VTISVGVSMLKQGDDPDALIERADACLYAAKRNGRNRVICEADPEFAIESHSRVA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtggtcaaggtgctcgacgaacacgaacgcacgatggcgttcgccgaagttgctctcggt
cagatccgttcgcttcgacagactgcaattccccgcaattacgagatctggtacgtctac
gccaccggctataacgcaccgctcaacaagatcatcaacgagacgctggcgcgccacggc
aagctgaccgaaggcgatctcgagcagatctacgagacctatctttcccacatcaagacc
accgaccgcatcgacaaggtcggcgcacgcgtcatcggcgagatcgacgacgtgatgacg
gtgctgagcgaagcactcgggatgaccggctcctacgatgcaagcctgtcgggcgcgacc
gagcaactgtcgtcggccaagaaccgcgaccagatcaagtcgatcgtcgagacgctgctg
cgttcgaccggcgagatgcgcgagaccaacaaggcgttggaagaccggctgaccctgtcc
aagaacgagatcagcaatctccagcagagcctggaggcgatccgcgccgagagcctgacc
gatccgctgacggggttgggcaatcgcaaatatttcgatcgcatgatcggcatggccgtg
cagagcgcgctcgcctcgggcgagccgctgtcgctgctgctgttcgacatcgatcatttc
aagtcgttcaacgattcctacggccatctcaccggcgaccaggtgttgcggctggtcggc
ctgtccatgaagcagaccatcaagggacaggacatcaccgcgcgctatggcggcgaggaa
ttcgcggtcctgctgcccaacacggcactgcgccaggccctcaccgttgcagatcacatc
cgccgcgccgtgatggcgaaggaattgaagaagaaatcgaccggcgagatcctcggccgc
gtcacaatctccgtcggcgtctccatgctcaagcagggcgacgatcccgacgcgctgatc
gagcgtgcggatgcctgcctctatgccgccaagcgcaacggccgcaaccgcgtgatctgc
gaggccgatccggaattcgcgatcgagtcgcacagccgggtggcctga

DBGET integrated database retrieval system