KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_58780Help
Entry
BJ6T_58780        CDS       T01848                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00010  Glycolysis / Gluconeogenesis
bju00620  Pyruvate metabolism
bju00640  Propanoate metabolism
bju00680  Methane metabolism
bju01100  Metabolic pathways
bju01110  Biosynthesis of secondary metabolites
bju01120  Microbial metabolism in diverse environments
bju01130  Biosynthesis of antibiotics
bju01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BJ6T_58780
   00620 Pyruvate metabolism
    BJ6T_58780
   00640 Propanoate metabolism
    BJ6T_58780
  Energy metabolism
   00680 Methane metabolism
    BJ6T_58780
Enzymes [BR:bju01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BJ6T_58780
Lipid biosynthesis proteins [BR:bju01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BJ6T_58780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: BAL11133
UniProt: G7DJS3
Position
complement(5935284..5936999)
Genome map
AA seq 571 aa AA seqDB search
MTTFQDARAFLLKHRTDYETAVKDFRWPDPVPFNWALDWFDELAKDADAKDRPALWIVDA
AQDKQTKLSFAALSQRSNQVANFLRAQGLKRGDHLLLLLGNVVPLWETMLAAMKLGVVVI
PATTLLTADELRDRLDRGKAKAVVAAQDQVAKFASLGAENIVRIVVGAASDGWLAYDEAT
KAAESFTADGPTNADDPMLLYFTSGTTAKPKLVRHSQRSYPVGHLSTMYWIGLKPGDVHL
NISSPGWAKHAWSCFFAPWNAGATVFVVNQPRFDAKGLLATIGRCGVTTLCAPPTVWRLF
IQENLASFKVSLREVCGAGEPLNPEVIDQVQAAWGLTIRDGYGQTETTALAGNSPGQKIK
VGSMGRPLPGYRVQVSDADGHPAKEGEVALVLGTERPAGLMQGYQGDDGKLSGAEGALYR
SGDVVFADEDGYLTFVGRSDDVFKSSDYRISPFELESVLLEHELVAEAAVVPSPDPIRLA
IPKAFVLLTSGAERSPETALSIFRHLHTRLAPFKRIRRLEIVTELPKTISGKIRRVQLRR
LERDDDRNDPLRGREFREEDFPELPKTRSET
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgacgacatttcaggacgcgcgcgcgtttctgctaaagcaccgcacggattacgagacg
gcggtcaaagacttccgctggcccgatccggttcccttcaattgggcgctcgactggttc
gacgaactcgcaaaggacgcggacgccaaggaccggcccgcgctctggatcgtcgatgcc
gcgcaggacaagcaaaccaagctgtctttcgcggcgctctcgcagcgctcgaaccaggtc
gccaacttcctgcgcgcgcagggcctgaagcgcggcgaccacctgctgctgctgctcggc
aacgtggttccgctgtgggagacgatgctggccgcgatgaagctcggcgtcgtcgtgatt
cccgccaccacgctgctcaccgcggacgagctgcgcgaccggctcgatcgcggcaaggcg
aaggcggtggtggcggcccaggaccaggtcgcgaaattcgcaagtctcggtgctgagaat
atcgtccgcatcgtcgtcggtgcggcttccgatggctggcttgcctatgacgaggcaacg
aaggctgcggagagctttacggctgacggtccgaccaacgccgacgacccgatgctgctc
tatttcacctctggcaccacggcgaaaccaaagctcgtgcgccacagccaacgcagctat
cccgtcggccatctctcgaccatgtactggatcgggctgaagccgggcgacgttcatctc
aatatttcatcgcccggttgggccaagcacgcctggagctgcttttttgcgccgtggaat
gcgggcgcgaccgtgttcgtggtcaaccagccgcgcttcgatgccaagggtctgctcgcc
accatcggccgctgcggcgttaccacgctgtgcgcgccgccgacggtatggcggctgttc
atccaggagaaccttgcgtcgttcaaggtgagcttgcgcgaggtctgcggcgccggcgag
ccgctcaatccggaagtgatcgaccaggtgcaggccgcctggggcctgaccatccgcgat
ggctacggccagaccgagaccaccgcgctggcgggcaactcgccggggcaaaagatcaag
gtcggctcgatgggccggccgctgccgggctatcgcgtgcaggtcagcgacgccgacggt
catcctgcgaaggaaggcgaggtggcgctggtgctcggcaccgagcgccccgccggcctg
atgcagggttatcagggcgacgacggcaagctgtcgggtgcggaaggcgcgctctaccgc
agcggtgacgtcgtgttcgcggacgaggatggctatctcactttcgttggccgttccgac
gacgtgttcaaatcctccgactatcgcatcagcccgttcgagctggagagcgtgctgctc
gagcatgagctcgtcgcggaagccgcggtggtgccgagcccggacccgatccggctcgcg
atccccaaggcctttgtgctgctgacatcaggtgcggagcgctcgcccgagacggcgctg
tccatcttcaggcatctgcatacgcgccttgcaccgttcaagcgcatccgccgccttgaa
atcgtcaccgagctgccgaagacgatctcgggcaagatccgccgcgtgcagctcagacgg
ctggagcgcgacgacgaccgcaacgatcccctgcgcggtcgggaattccgggaagaggat
tttccggagctgccgaaaacacggagcgagacctaa

DBGET integrated database retrieval system