KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_58800Help
Entry
BJ6T_58800        CDS       T01848                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00071  Fatty acid degradation
bju00280  Valine, leucine and isoleucine degradation
bju00281  Geraniol degradation
bju00310  Lysine degradation
bju00360  Phenylalanine metabolism
bju00362  Benzoate degradation
bju00380  Tryptophan metabolism
bju00410  beta-Alanine metabolism
bju00627  Aminobenzoate degradation
bju00640  Propanoate metabolism
bju00650  Butanoate metabolism
bju00903  Limonene and pinene degradation
bju00930  Caprolactam degradation
bju01100  Metabolic pathways
bju01110  Biosynthesis of secondary metabolites
bju01120  Microbial metabolism in diverse environments
bju01130  Biosynthesis of antibiotics
bju01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BJ6T_58800
   00650 Butanoate metabolism
    BJ6T_58800
  Lipid metabolism
   00071 Fatty acid degradation
    BJ6T_58800
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BJ6T_58800
   00310 Lysine degradation
    BJ6T_58800
   00360 Phenylalanine metabolism
    BJ6T_58800
   00380 Tryptophan metabolism
    BJ6T_58800
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BJ6T_58800
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BJ6T_58800
   00281 Geraniol degradation
    BJ6T_58800
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BJ6T_58800
   00627 Aminobenzoate degradation
    BJ6T_58800
   00930 Caprolactam degradation
    BJ6T_58800
Enzymes [BR:bju01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BJ6T_58800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: BAL11135
UniProt: G7DJS5
Position
complement(5937920..5938987)
Genome map
AA seq 355 aa AA seqDB search
MNSVEEGDLVARVEGAAGVIRLNRPKAINAVTLEMFRDIEKALDRFEADPAVAVILLEGA
GERGLCAGGDIRTLWESSKVNGDLGKILWREEYILNARIKRFPKPYVAFMDGIVMGGGVG
LSAHASHRVVTDRTRLAMPEVGLGFFPDVGGTFLLSRSPGEIGTYFGLTGQTMNGPDAIH
ARFADVVVPAAKLPELREALTRARSGATAADVSKLINGFATGETAGPVAAKEPVIDALFG
FDRMEDIVAALKRDGSEFALATLRTLGEKSPRGMVVTLKLLRLARTASSLEECLVREYRA
ALEVFRSDDFREGVRAAVIDKDRNPTWSPPRIEDVTQEMLAPYLAEIGADELKFN
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagtggaggagggcgatctggtcgcccgcgtcgagggcgcagccggcgtgatc
cggctcaaccgtccgaaggcgatcaatgccgtgacgctggagatgtttcgcgacatcgaa
aaggcgctcgaccgcttcgaggccgatccggccgtcgccgtgatcctgctggagggggcc
ggcgagcgcggcctgtgcgccggcggcgacatccgcacgctctgggaaagctccaaggtc
aatggtgacctcggcaagatcctgtggcgcgaggaatacatcctcaacgcccggatcaag
agattcccgaaaccctatgtcgcgttcatggacggcatcgtgatgggcggcggcgtcggg
ctctccgcccatgccagccaccgcgtcgtcaccgaccgcaccaggctcgcgatgcccgag
gtcgggctcggcttcttcccggatgtcggcggcacctttctgttgtcgcgctcgccgggg
gagatcggcacgtatttcggcctgaccggccagaccatgaacgggccggacgcgatccat
gctaggtttgccgatgtcgtggtgccggcggcgaaattgccggaactgcgcgaggctctg
acaagggctcgttccggcgcgaccgcggctgatgtcagcaagcttatcaacggttttgca
accggtgagaccgcgggaccggtcgccgcgaaagagcctgttatcgacgcgttgttcggc
ttcgaccgcatggaggacatcgtcgctgcactcaagcgcgacggctccgagttcgcgctg
gccacgttgaggacgctcggcgagaaatcgccacgcggaatggtggtgacgctgaagctg
ctgcggctcgcgcgcacggcgtcgagcttggaagagtgcctggtgcgtgagtatcgcgcc
gcgctggaggtcttccgcagcgatgatttccgcgaaggcgtgcgcgccgccgtgatcgac
aaggaccgcaatccgacctggtcgccgccgcggatcgaggatgtgacacaagagatgctt
gcgccgtatctcgccgagatcggcgccgacgaactgaagttcaactaa

DBGET integrated database retrieval system