KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_59050Help
Entry
BJ6T_59050        CDS       T01848                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bju00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bju00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:bju00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5966179..5968026
Genome map
AA seq 615 aa AA seqDB search
MTTFSPLASAWTRSKPPLLRFLGNCLNEFSAETAGHVADYIPELSKADPAHFGISLATLD
GHVYEVGDSRVPFTIQSMSKPFVFALALDLLGASRVESAIGVEPSGDPFNSIRLNSDNHP
FNPMVNAGAIACTGLIYDSKGADAFEQIRLALSRFAGRDLAVDEAVYSSESQTGDRNRAI
GYLLKTNAVISDNVAGVLEVYFRQCAVLVTARDIAVMAATLANRGVNPVTGEQVLTPYAI
SRTLSVMTSSGMYDYAGEWIYRIGIPAKSGVGGGILAALPARLGLGSYSPKLDKHGNSVR
GIKVCEALSSHYDLHMLNRSDDARNAVIADYDIGKSPSRRVRRPQEREILAAHEQEVRVI
ELVGTLSLSAVDYVSRRLAGQLRPQIVIFDLHRVTSTTRAGARLVAEAFEELAALNVTVV
ISGVRRASKEWDSLREWTAELKNVRDFYLLDTAIEWAEDQIVYRYGGSIDFHETTELAEQ
PLLSGMSEEELTDLASICAIRTFPSGAKIITTGAPADSLFFLRSGAVHVTLPDGVRLATL
TAGMAFGEMALLEPTRSADVFADMAATAFEVPLKDFERFRKQHPRASERIMRNLAQLLAD
RLIVANAKVDILTST
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgttctcgcctctcgcctccgcctggacccgctcgaagccgccattgctgcgg
tttctgggcaattgtctcaacgaattctcggccgagaccgcaggccacgtcgccgactac
atccccgagctgagcaaggccgaccctgcccattttggcatcagcctcgcgaccctggac
ggccatgtctacgaggtcggcgacagccgggtgcccttcaccatccagtcgatgtcgaag
cccttcgtgttcgcgctggcgctggacctcctgggcgccagccgcgtcgagagcgccatc
ggcgtcgagccctcgggcgatcccttcaactcgatcaggctcaattccgacaaccatccg
ttcaacccgatggtcaatgccggggcgatcgcctgcaccggactgatctatgacagcaag
ggcgcggacgccttcgagcagatccggctcgcgctcagccgctttgcggggcgcgatctc
gcggtggacgaggccgtttacagctcggagagccagaccggcgaccgcaaccgcgccatc
ggctacctgctcaagaccaatgcggtgatctcggacaatgtcgcaggcgtgctcgaagtc
tatttccggcaatgcgcggtgctggtcacggcgcgcgacatcgcggtgatggcggcgacg
ctcgccaatcgcggcgtcaatcccgtcacgggcgaacaggtgctgacgccctacgcgatc
tcgcgcacgctgtcggtgatgacgtcatcggggatgtacgactatgccggcgaatggatc
taccggatcggcattcccgccaagagcggcgtcggcggcggcatcctggccgcactcccc
gcccggctcgggctcggcagctattcgccgaagctcgacaagcacggcaacagcgtgcgc
ggcatcaaggtctgcgaggcgctgtcctcgcattacgacctgcacatgctcaaccgcagc
gacgacgcgcgcaacgccgtgatcgccgactacgacatcggcaagagcccgtcgcggcgc
gtgcgccggccgcaggagcgcgagattctggccgcgcacgagcaggaggtgcgggtcatc
gagctggtcggcacgctgtcgctgtcggcggtcgactatgtctcgcgccggctggccgga
cagctccggccgcaaatcgtgatcttcgatctccaccgcgtcacctccaccacgcgcgcc
ggcgcgcggctcgtggccgaggcgttcgaggagctggcggcgctgaacgtgaccgtcgtg
atttcaggcgtccgacgcgcttccaaggagtgggacagcctgcgggaatggacggcggaa
ctgaagaacgtccgcgacttctatctgctcgacaccgcgatcgaatgggcggaagaccag
atcgtctaccgctacggcggctcgatcgatttccacgagaccaccgagcttgccgaacag
ccgctgctatcaggcatgagcgaggaagagctgaccgacctcgcctcgatctgcgcgatc
cggacctttccatccggggcaaagatcatcacgacaggcgcccccgccgattccctgttc
ttcctgcgcagcggcgccgtgcatgtcaccctgcccgacggcgtgcggctggcgacgctg
accgccggcatggccttcggcgagatggcgctgctggaaccgacgcgttcggccgatgtt
ttcgcggacatggcagcgaccgcattcgaggtgccgctgaaggatttcgagcgcttccgc
aagcagcacccgagggcctccgagcgcatcatgcgcaatctggcgcagctgctcgccgac
cgcctgatcgtcgccaatgccaaggtcgacattctgacgtcgacgtga

DBGET integrated database retrieval system