KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_61700Help
Entry
BJ6T_61700        CDS       T01848                                 

Definition
alcohol dehydrogenase
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BJ6T_61700
Enzymes [BR:bju01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     BJ6T_61700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6231362..6232414)
Genome map
AA seq 350 aa AA seqDB search
MRAQVLRAYDEKLSGDQWVREEKVPDPKLTKSTDVIVRIGGAGVCRTDLHIIEGVWKPHM
DPTGEKLLPLIMGHENAGWIEEVGKEVEGLKKGDPVIVHPKITGGTCLACRRGFDMHGPG
TFPGLDCNGGYAEFLCTSERNIVPLPRTLAPKEVAPYADAGLTAYRAAKKATRHLLPGEF
CVVIGAGGLGHIGIQCLKAMCAADIIVVDKSEASLKLAEKSGADHLVKADGNELAAVLAM
TAGNGAEAVIDFVGEKGTTSKGLAMTRPMGSYYVVGYGEDIRVPTVDMVITEKNIIGNLV
GTWAELTELMALADRGLVQLATAEYRLADANEALHDLNAGKIHGRAVLIP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagagcccaagtattgagagcctatgacgagaagctttccggggaccagtgggtcagg
gaagagaaggtacctgatccgaagttgacgaaatcaacggacgtcatcgtccgcattggt
ggtgcgggcgtatgccgaaccgatcttcatatcatcgaaggcgtgtggaagccgcacatg
gatccgaccggtgaaaaactgcttcccctcatcatggggcacgaaaatgcagggtggatc
gaagaggttggcaaggaagtcgagggattgaagaagggtgatcccgtgatcgtccatccg
aagatcaccggtggcacctgccttgcctgtcgccgaggcttcgacatgcatggtcctggc
acatttccaggcctcgactgcaacggcggctatgcagaattcctttgcacctctgagcgc
aacattgtcccgctgccgcggactctcgcgccaaaggaagtcgcgccgtacgcggacgcg
ggcctcactgcgtatcgcgctgccaagaaagccacgcgtcaccttttgccgggcgaattc
tgcgtggttatcggtgcgggcgggttgggccacatcggaatccagtgcctcaaagcgatg
tgtgcggccgacattattgtcgtcgacaagtccgaagcatcgctgaaactggctgaaaaa
tcgggcgccgatcacctcgtgaaggctgacggcaacgaattggcagccgttctcgccatg
accgctggaaacggtgcggaagcggtgatcgatttcgtcggcgagaagggcacgacctcg
aagggcctggcaatgacccgcccgatgggtagctactacgtcgttggctacggcgaggac
atccgggtgccgaccgtcgacatggtgattaccgagaagaacattatcggcaatctggtc
ggcacatgggccgagttgaccgagctgatggcccttgcggatcgaggtctggttcaatta
gccacggcggagtatcggcttgcggacgccaacgaggcgttgcacgatctcaatgccgga
aaaattcatggacgggccgtcttgatcccttga

DBGET integrated database retrieval system