KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_62620Help
Entry
BJ6T_62620        CDS       T01848                                 

Definition
hypothetical protein
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BJ6T_62620
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BJ6T_62620
Enzymes [BR:bju01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BJ6T_62620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6344261..6345043
Genome map
AA seq 260 aa AA seqDB search
MLKDKVAIVTGSTSGIGLGIAKELARLRVNLVLNGFGDPGEIESIRSGIEREHGVRVVYD
GADMSKSDAVRRLIAATIETFGRLDILVNNAGIQFTAPVEEFPSAKWHAILDINLSAAFH
GIAAAVPQMKEQRWGRIVNIASTHGLVASTHKAAYVAAKHGLIGLTKVVGLETAGSGVTC
NAVCPGWVRTPLVEKQISDIAAQKNISQKDAAQALLGEKQPSSEFVSPEQLGGTVAFLCS
PAADQITGTAIAVDGGWTAQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaggataaggtcgctatcgtcaccggatcgaccagcggtatcgggctcggaatc
gccaaagagttggcaaggctccgcgtcaacctcgtgttgaacggcttcggcgaccccggc
gagatcgaatccatccgcagcgggatcgaacgcgagcacggcgtgcgcgtcgtctacgat
ggcgccgatatgtcgaagagcgatgccgtgcgccgattgatcgccgcgacaatcgagacg
ttcggacgcctcgacatcctcgtgaacaatgccggcatccagttcaccgcgccggtggaa
gaatttccgtcggccaagtggcatgcgatcctggacatcaatctgtcggccgcgtttcac
ggcatcgcggcggcggtgccccagatgaaggagcagcgctggggccggatcgtcaacatc
gcctcgacccacggcctcgtcgcatcgacgcacaaggccgcctacgtcgccgccaagcac
gggttgatcggcctgaccaaggtggttggcctggagaccgccggcagcggcgtgacctgt
aacgcagtctgtcccggctgggtgcggacgcccttggtggaaaagcagatcagcgacatc
gccgcacagaaaaacatcagtcaaaaggacgccgcccaggcactcttgggcgagaagcaa
ccgtcgtccgagttcgtctctccggagcagcttggagggacagtagcgttcctgtgttcg
cctgcggcggaccagatcacgggcaccgcgatcgcggtcgatggcggatggacggcacag
tag

DBGET integrated database retrieval system