KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_62620Help
Entry
BJ6T_62620        CDS       T01848                                 

Definition
hypothetical protein
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bju00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:bju00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6344261..6345043
Genome map
AA seq 260 aa AA seqDB search
MLKDKVAIVTGSTSGIGLGIAKELARLRVNLVLNGFGDPGEIESIRSGIEREHGVRVVYD
GADMSKSDAVRRLIAATIETFGRLDILVNNAGIQFTAPVEEFPSAKWHAILDINLSAAFH
GIAAAVPQMKEQRWGRIVNIASTHGLVASTHKAAYVAAKHGLIGLTKVVGLETAGSGVTC
NAVCPGWVRTPLVEKQISDIAAQKNISQKDAAQALLGEKQPSSEFVSPEQLGGTVAFLCS
PAADQITGTAIAVDGGWTAQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaggataaggtcgctatcgtcaccggatcgaccagcggtatcgggctcggaatc
gccaaagagttggcaaggctccgcgtcaacctcgtgttgaacggcttcggcgaccccggc
gagatcgaatccatccgcagcgggatcgaacgcgagcacggcgtgcgcgtcgtctacgat
ggcgccgatatgtcgaagagcgatgccgtgcgccgattgatcgccgcgacaatcgagacg
ttcggacgcctcgacatcctcgtgaacaatgccggcatccagttcaccgcgccggtggaa
gaatttccgtcggccaagtggcatgcgatcctggacatcaatctgtcggccgcgtttcac
ggcatcgcggcggcggtgccccagatgaaggagcagcgctggggccggatcgtcaacatc
gcctcgacccacggcctcgtcgcatcgacgcacaaggccgcctacgtcgccgccaagcac
gggttgatcggcctgaccaaggtggttggcctggagaccgccggcagcggcgtgacctgt
aacgcagtctgtcccggctgggtgcggacgcccttggtggaaaagcagatcagcgacatc
gccgcacagaaaaacatcagtcaaaaggacgccgcccaggcactcttgggcgagaagcaa
ccgtcgtccgagttcgtctctccggagcagcttggagggacagtagcgttcctgtgttcg
cctgcggcggaccagatcacgggcaccgcgatcgcggtcgatggcggatggacggcacag
tag

DBGET integrated database retrieval system