KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_64240Help
Entry
BJ6T_64240        CDS       T01848                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bju00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6531300..6532202)
Genome map
AA seq 300 aa AA seqDB search
MGRGINILGYDGIWEGGQNAPFRLDNLTAIKKAGFSHVRINFFGFKFMDRANVLDEVVLR
RLDAVIEEILARNLVPIVDEHDTHVCQRDVSECGEKLRAFWRQIAERYAGRYPRLVFEVL
NEPGGEMTSAGWNSLLNDCIGIIRRTNAERQVIAAVLNTDEIPIDDLALPADDRNLIVTF
HYYAPIRFTHQGAPWSETFARIGPLDWGSPDDEAKAAADFEKVSRWSEREKRPIYLGEFG
VYERAPSESRQRYLSFVARSADRRGWAWAYWQFDHDFAAFDSARQAWKPDILRALIPPAR
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
ttggggcgcgggatcaacattctcggttatgatggaatctgggagggcggtcagaacgcg
ccgttccgtctggacaatctgacggcgatcaaaaaggccggattctcgcacgtcaggatc
aatttcttcggcttcaagttcatggatcgcgcgaatgtgctggatgaggtcgtgctgaga
aggctcgatgccgtcatcgaggaaatcctcgccaggaacctcgttcccatcgtcgacgag
cacgacacgcatgtctgtcagcgtgatgtatccgaatgcggcgagaagctcagggcattc
tggcggcagatcgcggagcgctatgccggaagatatcccaggctcgtcttcgaggtcttg
aacgagccggggggagagatgacgtccgccggctggaattcgctcctcaacgattgtatc
ggcatcatccgccgcaccaacgccgagcggcaggtcattgctgccgttctcaacacagac
gagattcccatcgacgatctggctctccccgccgacgacaggaacctcatcgtcaccttt
cattattacgcgccgatacgcttcacgcatcagggtgcgccatggtccgagacgttcgcg
cgcatcgggccgctggattggggcagtccggacgacgaagccaaggcggccgctgatttc
gagaaggtcagccggtggtcggagagggagaaacgcccgatttatctcggcgagttcggg
gtatacgagcgggctccatccgagagccgccagagatacctgtcgttcgtggcgcgaagc
gccgacagacgcggctgggcatgggcctattggcagttcgaccatgatttcgcggccttt
gacagcgcccgtcaggcctggaagcccgacatcctgcgcgccctgatcccgccggcccgt
tga

DBGET integrated database retrieval system