KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_65460Help
Entry
BJ6T_65460        CDS       T01848                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BJ6T_65460
   00052 Galactose metabolism
    BJ6T_65460
Enzymes [BR:bju01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     BJ6T_65460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6687054..6688130)
Genome map
AA seq 358 aa AA seqDB search
MAGSKITKDIFGTLPDGRNVERIVLRGEGGFEARIITHGAVIQALIAPDAKGGCDDVVLG
HDAFAGYLAERKFFGATVGRYANRIANGRFSLDGETVQLPVNNGPNALHGGLDGFDRKLW
EIAGIDDGAEPGVTLTYSSPHGEENYPGRLDVRLTYRVTGPAELSLTMEARTDRPTVVNL
TNHSFFNLEGATSGTPILDHKLTVAAEHFLAIDPTAIPLPGPPRAVAGTAFDFRDGQAVG
ARIRESDQQLRNGRGYDHTYRLGRDGKLAFAARLEAPRSGRIMELLTNQPGLQVYSGNYL
DGTISGKGGKLIRQSDAMCLEPHIWPDAPNRPDFPSPRLNPGEVYRHHTVYRFGVRTP
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggctggctcaaaaataacaaaagacatcttcggaacgctgccggacggccgcaacgtc
gagcgtatcgtgctgcgcggggagggcgggttcgaagcccgcatcatcacccatggcgca
gtgatccaggcgctcatcgcgccagacgccaaaggcggttgcgacgacgtcgtgctcggc
catgacgcgttcgccggttatctcgccgaacgaaagttcttcggtgccacggtcggccgc
tacgccaaccgcattgccaacggacgattttcgctggacggcgagacggtgcagcttccg
gtcaacaacggtccgaatgcgctgcacggcggcctcgacgggttcgatcgcaagctctgg
gagatcgccgggatcgacgacggtgcggagccgggcgtgacgctcacctattcgagtccg
catggcgaagaaaattatcccggccggctcgacgtgcgcctgacctatcgcgtcaccggc
ccggccgagctgtcgttgacgatggaggcgcgaaccgaccggccgaccgtcgtcaacctg
accaaccacagcttcttcaatctggaaggcgcgacctcaggcacgcccattctcgaccac
aagctgacggtcgcggccgagcatttcctcgccatcgatcccaccgccatcccgctgcct
gggcccccgcgcgcggtggccggaacggcgttcgacttccgcgacggccaggccgtcggc
gcgcgcatccgcgagagcgatcagcaattgcggaacggcaggggctacgaccatacctac
cgtctcgggcgagatggcaagcttgctttcgcggcccggctggaggcgccgcgttcgggg
cgcatcatggagctcctgaccaatcagcccggccttcaggtctattccggcaactatctc
gacggcacgatctcgggcaagggcggcaagctcatccggcagtcggatgccatgtgtctc
gagccgcacatctggccggatgcgccgaaccggccggattttccgagcccgcgcctcaat
cccggcgaggtctaccgccatcacacggtctatcgctttggagtgaggacgccatga

DBGET integrated database retrieval system