KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_67050Help
Entry
BJ6T_67050        CDS       T01848                                 

Definition
hypothetical protein
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BJ6T_67050
Enzymes [BR:bju01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BJ6T_67050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6865701..6866561
Genome map
AA seq 286 aa AA seqDB search
MNASPSPSVPPAGSAGPDVLRTLLERPIPAVMGVLNVTPDSFSDGGEFIAPELALARARA
MIEAGVDIIDIGAESTRPYTGARPVTAADELARLKPVLSGVVALGVPVSIDSMKAEVVAF
ALDQGAAIANDVWGLQRDTGMAQLIAARGVPVIVMHNRETVDSDIDIVADMKAFFLRSLD
IAAKAGIAHDKIVLDPGIGFGKTAEQSMTALARLREFDMFGLPILVGASRKRFIASVSPS
EPKERLAGSIAAHLIAAQRGAKIIRTHDVAETLQALRVANAIESKQ
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcctcgccctccccatccgtcccgccggccggctcggccgggcccgacgtgctg
cggacgctgctggagcggccgattccggcagtgatgggcgtgctcaacgtcaccccggat
tccttttccgatggtggtgagttcatcgcgcccgagctggcgcttgcgcgggcgcgggca
atgatcgaggccggcgtcgacatcatcgacatcggtgccgagtccacccggccctacacg
ggcgcccggccggtgacggcggcagacgagctggcccggctgaagccggtgctgtcaggc
gtggtggcgctcggcgtccccgtatcgatcgacagcatgaaggccgaagtcgtggccttt
gcgctcgaccagggtgctgcgatcgccaacgacgtctggggcctgcagcgcgacaccggc
atggcgcagctcatcgccgcgcgcggcgtccccgtcatcgtcatgcataaccgcgagacg
gtcgattccgacatcgacatcgtcgcggacatgaaggcgttcttcctgcgctcgctcgat
atcgccgccaaggccggcatcgcgcacgacaagatcgtgctcgatcccggcatcggcttc
ggcaagacggccgagcagagcatgaccgcgctggcgcggctgcgcgaattcgacatgttc
ggcctgccgatcctcgttggtgcctcgcgaaaacgcttcatcgcctcggtgtcgccctcg
gagccgaaagaacggctcgccggctcgatcgccgcgcatctgatcgccgcacagcgcggc
gccaagatcatccggacccatgacgtcgccgagaccttgcaggccctgcgggtcgcgaac
gcaatcgagagcaagcaatga

DBGET integrated database retrieval system