KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_68860Help
Entry
BJ6T_68860        CDS       T01848                                 

Definition
hypothetical protein
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BJ6T_68860
  Amino acid metabolism
   00380 Tryptophan metabolism
    BJ6T_68860
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BJ6T_68860
Enzymes [BR:bju01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BJ6T_68860
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     BJ6T_68860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7066837..7070073)
Genome map
AA seq 1078 aa AA seqDB search
MSSKNRLDPIPQPPTKPVVGNMLSLDSAAPVQHLTRLAKELGPIFWLDMMGSPIVVVSGH
DLVDELSDEKRFDKTVRGALRRVRAVGGDGLFTADTREPNWSKAHNILLQPFGNRAMQSY
HPSMVDIAEQLVNKWERLNADDEIDVVHDMTALTLDTIGLCGFEYRFNSFYRRDYHPFVE
SLVRSLETIMMTRGLPFEQLWMQKRRKTLAEDVAFMNKMVDEIIAERRKSAEGVDDKKDM
LAAMMTGVDRSTGEQLDDINIRYQINTFLIAGHETTSGLLSYTLYALLKHPDILKKAYDE
VDRVFGPDVNAKPTYQQVTQLTYITQILKEALRLWPPAPAYGISPLNDETIGGGNYRLRK
GTFITILVTALHRDPSVWGPNPDAFNPENFSREAEAKRPINAWKPFGNGQRACIGRGFAM
HEAALALGMVLQRFKLIDHQRYQMHLKETLTMKPEGFKIKVRPRADRERGAYGGPVAVAS
SGPRAPRKPTTRPGHNTPMLVLYGSNLGTAEELATRMADLAEINGFAVHLGPLDDYVGKL
PHEGGVLIICASYNGAPPDNATQFVKWLGDDLPEDAFANVRYAVFGCGNSDWAATYQSVP
RFIDEQLSKHGARAVYPRGEGDARSDLDGQFQKWFPAAAQVATKEFGIDWNFTRTAEDDP
LYAIEPVAVTAVNTIVAQGGAVAMKVLVNDELQNKFGANPSERSTRHIEVQLPSNITYRV
GDHLSVVPRNDPTLVDSVARRFGFLPADQIRLQVAEGRRAQLPVGDAVSVGRLLSEFVEL
QQVATRKQIQIMAEHTRCPVTKPKLLAFVGEEAEPLERYRTEILARRKSVFDMLLEYPAC
ELPFHVYLEMLSLLAPRYYSISSSPSVDPARCSVTVGVVEGPAASGRGTYKGICSNYLSN
RRAGDAIYATVRETKAGFRLPDESSVPIIMIGPGTGLAPFRGFLQERAARKAKGAALGPA
MLFFGCRHPDQDFLYAEELKGLAASGITELFTAFSRADGPKTYVQHMLAAQKDRVWPLIE
QGAIIYVCGDGGKMEPDVKAALVAIHREKSGSDAAAAARWIEEMGAKNRYVLDVWAGG
NT seq 3237 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccaagaaccgtctggacccaattccgcagccgccgaccaagccggtggtcggc
aacatgctgtcgctggattcggccgcgccggtgcagcacctgacccggcttgccaaggag
ctcgggccgatcttctggctcgacatgatgggctcgccgatcgtcgtcgtctccggccac
gatctcgtcgacgagctctccgatgagaagcgcttcgacaagacggtgcgcggtgcgctg
cgccgcgtgcgcgcggtcggcggcgacggcctgttcacggccgacaccagggagccgaac
tggagcaaggcgcacaacatcctgcttcagccgttcggcaaccgcgccatgcagtcctat
cacccgagcatggtcgatatcgccgagcagctcgtcaacaaatgggaacggctcaacgcc
gacgacgagatcgacgtcgtccatgacatgaccgcgctgacgctggacacgatcggcctg
tgcggcttcgagtaccgcttcaattccttctatcggcgcgactaccatcccttcgtcgag
tcgctggtgcgctcgctcgaaaccatcatgatgacgcgcggcctgccgttcgaacagctc
tggatgcagaagcggcgcaagacgctcgctgaagacgtcgccttcatgaacaagatggtc
gacgagatcatcgccgagcgccgcaagagcgccgaaggggtcgacgacaagaaggacatg
ctcgccgcgatgatgaccggcgtcgaccgctcgaccggggagcagcttgacgacatcaac
atccgctaccagatcaacacgttcctgatcgcggggcatgagaccaccagcggcctgctg
tcctacacgctctacgctctgctcaagcacccggacattctcaagaaggcctatgacgag
gtcgaccgcgtcttcggccccgacgtcaacgcgaagccgacctaccagcaggtgacgcag
ctcacctacatcacgcagatcctcaaggaagccctgcggctgtggccgccggcgccggcc
tatggcatctcgccgctgaacgacgagaccatcggcggcggcaactacaggctcaggaag
ggcaccttcatcaccatcctggtgacggcgctgcatcgcgatccctcggtctggggtcca
aatcccgacgcgttcaatcccgagaatttcagccgcgaggcggaggccaagcggccgatc
aatgcctggaagccgttcggcaacggccagcgcgcctgcatcggacgcggcttcgcgatg
cacgaggccgcgctcgcgctcggcatggtcctccagcgcttcaagctgatcgaccaccag
cgctatcagatgcatctgaaagaaacgctgaccatgaagcccgaaggcttcaagatcaag
gtacgtccgcgcgccgatcgcgagcgcggcgcctatggcggccctgtcgctgtcgcgtcc
tcggggccgcgggcgcctcgtaagccgacgacgcggccgggccacaatacgccgatgctg
gtgctttacggctccaacctcggcacggccgaggaactcgcgacgcgcatggccgacctt
gccgagatcaacggctttgccgtgcatctcgggccgctcgacgattacgtcggcaagctg
ccgcacgagggcggcgtgctgatcatctgcgcctcctataacggcgcgccgcctgacaac
gcgacgcaattcgtcaaatggctcggcgacgatctgcctgaggatgcctttgccaatgtg
cgctacgccgtgttcggctgcggcaacagcgattgggcggcgacctatcaatcggtgccg
cgcttcatcgacgagcaattgtcgaagcacggtgcacgcgcggtctatccgcgcggcgaa
ggcgatgcgcgcagcgatctcgacggccagttccagaaatggttcccggcggctgcgcaa
gtcgcgaccaaggaattcggcatcgactggaatttcacccgtaccgcggaggacgatccg
ctctatgcgatcgagcctgtggcagtaaccgccgtcaacaccatcgtcgcgcagggcggt
gctgtcgcgatgaaggtgctggtcaatgacgagctccagaacaagttcggcgccaatccg
tcggagcgttcaacgcgccatatcgaggtgcagctgccgtccaacatcacctatcgcgtg
ggcgatcacttaagcgtcgttccgcgcaacgatccgacgctggtggattcggttgcccgc
cgcttcggcttcctgccggccgaccagatcaggcttcaggtcgctgaaggccggcgcgcg
cagctgccggtcggcgatgccgtttcggtcggacgtctgctcagcgagttcgtcgagttg
cagcaggtggcgacacggaagcagatccagatcatggccgagcacacccgctgcccggtc
accaagccgaagctgctggccttcgttggcgaggaagccgagccgctcgagcgttatcgc
accgagattctggcaaggcgcaaatcggtattcgacatgttgctcgaatatccggcctgc
gagttgccgttccacgtttatctggaaatgctctcgctgctggcaccgcgctattactcg
atctcctcttcgccgtcggtcgacccggcgcggtgcagcgtcacggtcggcgtggtcgaa
gggccggctgcttccggccgcggcacctacaagggcatctgctcgaactatctctccaac
cgacgtgcgggcgatgcgatctatgccactgtgcgcgagaccaaggccggcttccggctc
ccggatgagtcatcggtgccgatcatcatgatcggcccgggcacggggcttgcgccgttc
cgcggctttctccaggagcgcgccgcgcgcaaggcgaaaggcgccgccctcggtccggcc
atgctgttcttcggctgccgccatcccgaccaggattttctctacgcggaggagttgaag
gggctggcggcaagcggcatcaccgagctcttcacggcattctcgcgtgcagatggaccg
aagacctatgtgcagcacatgcttgccgcacagaaggacagggtctggccgctgatcgag
cagggcgccatcatctatgtctgcggcgatggcggcaagatggagcccgacgtgaaggcc
gctctcgttgcgatccatcgcgagaagagcggcagcgacgccgccgcggctgcgcgctgg
atcgaggagatgggcgcgaagaaccggtatgtgctggacgtctgggcaggagggtga

DBGET integrated database retrieval system