KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_68860Help
Entry
BJ6T_68860        CDS       T01848                                 

Definition
hypothetical protein
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bju00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:bju00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bju00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7066837..7070073)
Genome map
AA seq 1078 aa AA seqDB search
MSSKNRLDPIPQPPTKPVVGNMLSLDSAAPVQHLTRLAKELGPIFWLDMMGSPIVVVSGH
DLVDELSDEKRFDKTVRGALRRVRAVGGDGLFTADTREPNWSKAHNILLQPFGNRAMQSY
HPSMVDIAEQLVNKWERLNADDEIDVVHDMTALTLDTIGLCGFEYRFNSFYRRDYHPFVE
SLVRSLETIMMTRGLPFEQLWMQKRRKTLAEDVAFMNKMVDEIIAERRKSAEGVDDKKDM
LAAMMTGVDRSTGEQLDDINIRYQINTFLIAGHETTSGLLSYTLYALLKHPDILKKAYDE
VDRVFGPDVNAKPTYQQVTQLTYITQILKEALRLWPPAPAYGISPLNDETIGGGNYRLRK
GTFITILVTALHRDPSVWGPNPDAFNPENFSREAEAKRPINAWKPFGNGQRACIGRGFAM
HEAALALGMVLQRFKLIDHQRYQMHLKETLTMKPEGFKIKVRPRADRERGAYGGPVAVAS
SGPRAPRKPTTRPGHNTPMLVLYGSNLGTAEELATRMADLAEINGFAVHLGPLDDYVGKL
PHEGGVLIICASYNGAPPDNATQFVKWLGDDLPEDAFANVRYAVFGCGNSDWAATYQSVP
RFIDEQLSKHGARAVYPRGEGDARSDLDGQFQKWFPAAAQVATKEFGIDWNFTRTAEDDP
LYAIEPVAVTAVNTIVAQGGAVAMKVLVNDELQNKFGANPSERSTRHIEVQLPSNITYRV
GDHLSVVPRNDPTLVDSVARRFGFLPADQIRLQVAEGRRAQLPVGDAVSVGRLLSEFVEL
QQVATRKQIQIMAEHTRCPVTKPKLLAFVGEEAEPLERYRTEILARRKSVFDMLLEYPAC
ELPFHVYLEMLSLLAPRYYSISSSPSVDPARCSVTVGVVEGPAASGRGTYKGICSNYLSN
RRAGDAIYATVRETKAGFRLPDESSVPIIMIGPGTGLAPFRGFLQERAARKAKGAALGPA
MLFFGCRHPDQDFLYAEELKGLAASGITELFTAFSRADGPKTYVQHMLAAQKDRVWPLIE
QGAIIYVCGDGGKMEPDVKAALVAIHREKSGSDAAAAARWIEEMGAKNRYVLDVWAGG
NT seq 3237 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccaagaaccgtctggacccaattccgcagccgccgaccaagccggtggtcggc
aacatgctgtcgctggattcggccgcgccggtgcagcacctgacccggcttgccaaggag
ctcgggccgatcttctggctcgacatgatgggctcgccgatcgtcgtcgtctccggccac
gatctcgtcgacgagctctccgatgagaagcgcttcgacaagacggtgcgcggtgcgctg
cgccgcgtgcgcgcggtcggcggcgacggcctgttcacggccgacaccagggagccgaac
tggagcaaggcgcacaacatcctgcttcagccgttcggcaaccgcgccatgcagtcctat
cacccgagcatggtcgatatcgccgagcagctcgtcaacaaatgggaacggctcaacgcc
gacgacgagatcgacgtcgtccatgacatgaccgcgctgacgctggacacgatcggcctg
tgcggcttcgagtaccgcttcaattccttctatcggcgcgactaccatcccttcgtcgag
tcgctggtgcgctcgctcgaaaccatcatgatgacgcgcggcctgccgttcgaacagctc
tggatgcagaagcggcgcaagacgctcgctgaagacgtcgccttcatgaacaagatggtc
gacgagatcatcgccgagcgccgcaagagcgccgaaggggtcgacgacaagaaggacatg
ctcgccgcgatgatgaccggcgtcgaccgctcgaccggggagcagcttgacgacatcaac
atccgctaccagatcaacacgttcctgatcgcggggcatgagaccaccagcggcctgctg
tcctacacgctctacgctctgctcaagcacccggacattctcaagaaggcctatgacgag
gtcgaccgcgtcttcggccccgacgtcaacgcgaagccgacctaccagcaggtgacgcag
ctcacctacatcacgcagatcctcaaggaagccctgcggctgtggccgccggcgccggcc
tatggcatctcgccgctgaacgacgagaccatcggcggcggcaactacaggctcaggaag
ggcaccttcatcaccatcctggtgacggcgctgcatcgcgatccctcggtctggggtcca
aatcccgacgcgttcaatcccgagaatttcagccgcgaggcggaggccaagcggccgatc
aatgcctggaagccgttcggcaacggccagcgcgcctgcatcggacgcggcttcgcgatg
cacgaggccgcgctcgcgctcggcatggtcctccagcgcttcaagctgatcgaccaccag
cgctatcagatgcatctgaaagaaacgctgaccatgaagcccgaaggcttcaagatcaag
gtacgtccgcgcgccgatcgcgagcgcggcgcctatggcggccctgtcgctgtcgcgtcc
tcggggccgcgggcgcctcgtaagccgacgacgcggccgggccacaatacgccgatgctg
gtgctttacggctccaacctcggcacggccgaggaactcgcgacgcgcatggccgacctt
gccgagatcaacggctttgccgtgcatctcgggccgctcgacgattacgtcggcaagctg
ccgcacgagggcggcgtgctgatcatctgcgcctcctataacggcgcgccgcctgacaac
gcgacgcaattcgtcaaatggctcggcgacgatctgcctgaggatgcctttgccaatgtg
cgctacgccgtgttcggctgcggcaacagcgattgggcggcgacctatcaatcggtgccg
cgcttcatcgacgagcaattgtcgaagcacggtgcacgcgcggtctatccgcgcggcgaa
ggcgatgcgcgcagcgatctcgacggccagttccagaaatggttcccggcggctgcgcaa
gtcgcgaccaaggaattcggcatcgactggaatttcacccgtaccgcggaggacgatccg
ctctatgcgatcgagcctgtggcagtaaccgccgtcaacaccatcgtcgcgcagggcggt
gctgtcgcgatgaaggtgctggtcaatgacgagctccagaacaagttcggcgccaatccg
tcggagcgttcaacgcgccatatcgaggtgcagctgccgtccaacatcacctatcgcgtg
ggcgatcacttaagcgtcgttccgcgcaacgatccgacgctggtggattcggttgcccgc
cgcttcggcttcctgccggccgaccagatcaggcttcaggtcgctgaaggccggcgcgcg
cagctgccggtcggcgatgccgtttcggtcggacgtctgctcagcgagttcgtcgagttg
cagcaggtggcgacacggaagcagatccagatcatggccgagcacacccgctgcccggtc
accaagccgaagctgctggccttcgttggcgaggaagccgagccgctcgagcgttatcgc
accgagattctggcaaggcgcaaatcggtattcgacatgttgctcgaatatccggcctgc
gagttgccgttccacgtttatctggaaatgctctcgctgctggcaccgcgctattactcg
atctcctcttcgccgtcggtcgacccggcgcggtgcagcgtcacggtcggcgtggtcgaa
gggccggctgcttccggccgcggcacctacaagggcatctgctcgaactatctctccaac
cgacgtgcgggcgatgcgatctatgccactgtgcgcgagaccaaggccggcttccggctc
ccggatgagtcatcggtgccgatcatcatgatcggcccgggcacggggcttgcgccgttc
cgcggctttctccaggagcgcgccgcgcgcaaggcgaaaggcgccgccctcggtccggcc
atgctgttcttcggctgccgccatcccgaccaggattttctctacgcggaggagttgaag
gggctggcggcaagcggcatcaccgagctcttcacggcattctcgcgtgcagatggaccg
aagacctatgtgcagcacatgcttgccgcacagaaggacagggtctggccgctgatcgag
cagggcgccatcatctatgtctgcggcgatggcggcaagatggagcccgacgtgaaggcc
gctctcgttgcgatccatcgcgagaagagcggcagcgacgccgccgcggctgcgcgctgg
atcgaggagatgggcgcgaagaaccggtatgtgctggacgtctgggcaggagggtga

DBGET integrated database retrieval system