KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_69140Help
Entry
BJ6T_69140        CDS       T01848                                 

Definition
(RefSeq) hypothetical protein
  KO
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BJ6T_69140
   01230 Biosynthesis of amino acids
    BJ6T_69140
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BJ6T_69140
   00030 Pentose phosphate pathway
    BJ6T_69140
   00051 Fructose and mannose metabolism
    BJ6T_69140
  Energy metabolism
   00680 Methane metabolism
    BJ6T_69140
Enzymes [BR:bju01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BJ6T_69140
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     BJ6T_69140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7102789..7103862
Genome map
AA seq 357 aa AA seqDB search
MIATVEGEIAKAICNGLLIDGFICHTGDDIAIIMTHTRGEGSSDVHQLAWKSFLAATSVA
KTSGLYGAGQDLLADAPSGNIRGAGPGVAELSFDHSLSGVRPAESFMVFAADKCGPGAYN
LPLYLAFADPMYCAGLMLPSMIKGFRFHVIDMDNTAGDSLLELDAPADSYDIAALLRDNE
RFGIDRIISRTHGEVVVAVSAQRLHAIAGKYTGKDDPVAIVRNQGIFPAPEEIISPFAKA
HFVGGDARGSHVMPLMPVPLNTPVTGMYCLPIVSCVGFSIDREGRFAESYTDFFDNPAWD
EVRRRAQRKAIEMRSQGWSGAAMLPYSELEYGGFRDTVSGLLKRFRLRDDRRPEAAE
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgactgtcgaaggcgagattgcgaaggcgatctgcaatggtctgctgatcgac
ggtttcatctgccacaccggcgacgacattgcgatcatcatgacgcacacgcggggtgaa
ggaagctcggatgtccatcaactcgcctggaagtcgttcctcgcggccacctcggtcgcg
aaaacctccgggctctatggcgctggccaggatcttctcgccgacgcgccttccgggaac
attcgcggcgccggcccaggcgtcgccgagctcagcttcgaccacagcctctccggcgtg
cgacccgcggagtccttcatggtgttcgcggccgacaaatgcggccccggcgcctacaac
ctgccgctctatctcgcctttgccgaccccatgtactgcgctgggctgatgctgccttcg
atgatcaagggattccgcttccatgtcatcgacatggacaacacagccggcgacagccta
ctcgagctcgacgcacccgccgacagctacgacatcgccgccctgcttcgcgacaacgag
cgcttcggcatcgatcgcatcatttctcgaacccatggcgaggtcgtcgtggccgtttcg
gcgcagcgcctccacgcgatcgcaggcaagtacaccggcaaggatgatccagtcgcgatc
gtcaggaaccaggggattttcccggctccagaggaaataatctcgccgttcgccaaagca
cacttcgtgggcggcgacgcacgcggctcgcatgtgatgccgctcatgccggtgccactc
aacacgccggttaccggcatgtactgcctgccgatcgtttcttgcgtcggcttttcgatc
gacagggaaggccgctttgccgagtcctacaccgatttcttcgacaacccagcatgggat
gaggtccgccggcgcgcccagcgcaaggccatcgagatgcgcagccaaggctggtctggc
gccgccatgctaccctattccgaactggaatatggcggcttccgcgacaccgtgtccggt
ctgctgaagcgttttcgactgcgcgacgatcgcaggccggaagcggccgagtag

DBGET integrated database retrieval system