KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_69150Help
Entry
BJ6T_69150        CDS       T01848                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:bju01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bju01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bju00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bju00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bju00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bju00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:bju00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7103952..7105139
Genome map
AA seq 395 aa AA seqDB search
MAKKRIGILTGGGDVAGLNAVIKSVTYRGSEDDIEVVGLRRGWEALTHLNLDDPNSRSHY
VIPLNRENTRTIDRRGGTVLHSSRVNPSKIQKLPDHLVDNDVPVSLSTDGGIATKTWDLT
SRVLANLSGLGIEHLIAIGGDDTLSYAAKLNELGVKIIAIPKTMDNDVRNTEYCIGFSTA
ITRASDAIQRQRTTVGSHERIGIFRVFGRDAGFTALYTAYATSIRCVIPEYKVDLDKLIQ
LLIEDKRANPSNYALIVLSEGAQWEGYKLREYGEPDAFGHRKKANVAESLADEIKQRTGE
ETITSDLTYDLRSGDPDFIDKLVALTFGNMAYDAMLESKSGLMSALVEGRYDLVPIPDAK
LGPRKLDVASSYNTERYRPLYANKQGLPIFLNRAS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaaacgcatcggcattctcacgggcggcggcgacgtcgccggcctcaatgcc
gtcatcaagagcgtgacttatcgcggcagtgaggacgacatcgaggttgtcggtctgcgc
cgtggttgggaggccctcacgcacctgaacctcgacgacccaaacagcagatcccactac
gtcatcccgctgaatcgtgaaaacactcgaaccatcgaccggcgcggcggcaccgtgctg
cactcgagccgcgtcaatccctccaaaatacaaaagctgcccgatcatctcgtcgacaat
gatgttccggtctcgctgagcaccgacggcggcatcgcgacaaagacgtgggacctcacc
agccgggtgctcgctaacctttcgggacttggcatcgaacacctgatcgccatcggcggc
gacgacacgctcagttatgcggccaagctcaacgaactcggcgtcaagatcatcgccatc
ccgaagacgatggataatgacgtccgcaacaccgagtactgcatcggcttctcgaccgcg
atcacccgcgccagcgatgccatccagcggcagcgcaccaccgtcggctcgcacgagcga
attggcattttccgcgtctttggccgcgatgccggatttacggcactctacaccgcgtat
gcgacctcgatacgatgcgtcataccggagtataaggtcgacctcgacaagctgatccag
ttgctcatcgaggacaagcgcgccaatccaagcaactacgcgctgatcgtactcagcgag
ggagctcagtgggaaggctacaagctgcgggaatacggcgagcctgacgcctttggtcac
cgcaagaaggccaacgtggcggaatcgcttgccgacgagatcaagcagcgcaccggcgag
gagacgatcacctccgatctcacttacgatctgcgatcgggtgatccggacttcatcgac
aagcttgtggccctgactttcggtaacatggcctacgatgccatgctggaaagcaagtcc
ggcctcatgtcggcgctggtcgagggccgctacgacctcgtccccatccctgacgccaag
cttggtccgcgcaaattggacgttgcgagcagctacaacacggagcgctaccgccccctc
tacgccaataagcaggggctgccgatctttctcaaccgcgcgtcttag

DBGET integrated database retrieval system