KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_69150Help
Entry
BJ6T_69150        CDS       T01848                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BJ6T_69150
   01230 Biosynthesis of amino acids
    BJ6T_69150
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BJ6T_69150
   00030 Pentose phosphate pathway
    BJ6T_69150
   00051 Fructose and mannose metabolism
    BJ6T_69150
   00052 Galactose metabolism
    BJ6T_69150
  Energy metabolism
   00680 Methane metabolism
    BJ6T_69150
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BJ6T_69150
Enzymes [BR:bju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BJ6T_69150
Protein phosphatases and associated proteins [BR:bju01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BJ6T_69150
Messenger RNA biogenesis [BR:bju03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BJ6T_69150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7103952..7105139
Genome map
AA seq 395 aa AA seqDB search
MAKKRIGILTGGGDVAGLNAVIKSVTYRGSEDDIEVVGLRRGWEALTHLNLDDPNSRSHY
VIPLNRENTRTIDRRGGTVLHSSRVNPSKIQKLPDHLVDNDVPVSLSTDGGIATKTWDLT
SRVLANLSGLGIEHLIAIGGDDTLSYAAKLNELGVKIIAIPKTMDNDVRNTEYCIGFSTA
ITRASDAIQRQRTTVGSHERIGIFRVFGRDAGFTALYTAYATSIRCVIPEYKVDLDKLIQ
LLIEDKRANPSNYALIVLSEGAQWEGYKLREYGEPDAFGHRKKANVAESLADEIKQRTGE
ETITSDLTYDLRSGDPDFIDKLVALTFGNMAYDAMLESKSGLMSALVEGRYDLVPIPDAK
LGPRKLDVASSYNTERYRPLYANKQGLPIFLNRAS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaaacgcatcggcattctcacgggcggcggcgacgtcgccggcctcaatgcc
gtcatcaagagcgtgacttatcgcggcagtgaggacgacatcgaggttgtcggtctgcgc
cgtggttgggaggccctcacgcacctgaacctcgacgacccaaacagcagatcccactac
gtcatcccgctgaatcgtgaaaacactcgaaccatcgaccggcgcggcggcaccgtgctg
cactcgagccgcgtcaatccctccaaaatacaaaagctgcccgatcatctcgtcgacaat
gatgttccggtctcgctgagcaccgacggcggcatcgcgacaaagacgtgggacctcacc
agccgggtgctcgctaacctttcgggacttggcatcgaacacctgatcgccatcggcggc
gacgacacgctcagttatgcggccaagctcaacgaactcggcgtcaagatcatcgccatc
ccgaagacgatggataatgacgtccgcaacaccgagtactgcatcggcttctcgaccgcg
atcacccgcgccagcgatgccatccagcggcagcgcaccaccgtcggctcgcacgagcga
attggcattttccgcgtctttggccgcgatgccggatttacggcactctacaccgcgtat
gcgacctcgatacgatgcgtcataccggagtataaggtcgacctcgacaagctgatccag
ttgctcatcgaggacaagcgcgccaatccaagcaactacgcgctgatcgtactcagcgag
ggagctcagtgggaaggctacaagctgcgggaatacggcgagcctgacgcctttggtcac
cgcaagaaggccaacgtggcggaatcgcttgccgacgagatcaagcagcgcaccggcgag
gagacgatcacctccgatctcacttacgatctgcgatcgggtgatccggacttcatcgac
aagcttgtggccctgactttcggtaacatggcctacgatgccatgctggaaagcaagtcc
ggcctcatgtcggcgctggtcgagggccgctacgacctcgtccccatccctgacgccaag
cttggtccgcgcaaattggacgttgcgagcagctacaacacggagcgctaccgccccctc
tacgccaataagcaggggctgccgatctttctcaaccgcgcgtcttag

DBGET integrated database retrieval system