KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_69150Help
Entry
BJ6T_69150        CDS       T01848                                 

Definition
(GenBank) hypothetical protein
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00010  Glycolysis / Gluconeogenesis
bju00030  Pentose phosphate pathway
bju00051  Fructose and mannose metabolism
bju00052  Galactose metabolism
bju00680  Methane metabolism
bju01100  Metabolic pathways
bju01110  Biosynthesis of secondary metabolites
bju01120  Microbial metabolism in diverse environments
bju01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BJ6T_69150
   00030 Pentose phosphate pathway
    BJ6T_69150
   00051 Fructose and mannose metabolism
    BJ6T_69150
   00052 Galactose metabolism
    BJ6T_69150
  Energy metabolism
   00680 Methane metabolism
    BJ6T_69150
Enzymes [BR:bju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BJ6T_69150
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     BJ6T_69150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: BAL12164
UniProt: G7D4C3
Position
7103952..7105139
Genome map
AA seq 395 aa AA seqDB search
MAKKRIGILTGGGDVAGLNAVIKSVTYRGSEDDIEVVGLRRGWEALTHLNLDDPNSRSHY
VIPLNRENTRTIDRRGGTVLHSSRVNPSKIQKLPDHLVDNDVPVSLSTDGGIATKTWDLT
SRVLANLSGLGIEHLIAIGGDDTLSYAAKLNELGVKIIAIPKTMDNDVRNTEYCIGFSTA
ITRASDAIQRQRTTVGSHERIGIFRVFGRDAGFTALYTAYATSIRCVIPEYKVDLDKLIQ
LLIEDKRANPSNYALIVLSEGAQWEGYKLREYGEPDAFGHRKKANVAESLADEIKQRTGE
ETITSDLTYDLRSGDPDFIDKLVALTFGNMAYDAMLESKSGLMSALVEGRYDLVPIPDAK
LGPRKLDVASSYNTERYRPLYANKQGLPIFLNRAS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaaacgcatcggcattctcacgggcggcggcgacgtcgccggcctcaatgcc
gtcatcaagagcgtgacttatcgcggcagtgaggacgacatcgaggttgtcggtctgcgc
cgtggttgggaggccctcacgcacctgaacctcgacgacccaaacagcagatcccactac
gtcatcccgctgaatcgtgaaaacactcgaaccatcgaccggcgcggcggcaccgtgctg
cactcgagccgcgtcaatccctccaaaatacaaaagctgcccgatcatctcgtcgacaat
gatgttccggtctcgctgagcaccgacggcggcatcgcgacaaagacgtgggacctcacc
agccgggtgctcgctaacctttcgggacttggcatcgaacacctgatcgccatcggcggc
gacgacacgctcagttatgcggccaagctcaacgaactcggcgtcaagatcatcgccatc
ccgaagacgatggataatgacgtccgcaacaccgagtactgcatcggcttctcgaccgcg
atcacccgcgccagcgatgccatccagcggcagcgcaccaccgtcggctcgcacgagcga
attggcattttccgcgtctttggccgcgatgccggatttacggcactctacaccgcgtat
gcgacctcgatacgatgcgtcataccggagtataaggtcgacctcgacaagctgatccag
ttgctcatcgaggacaagcgcgccaatccaagcaactacgcgctgatcgtactcagcgag
ggagctcagtgggaaggctacaagctgcgggaatacggcgagcctgacgcctttggtcac
cgcaagaaggccaacgtggcggaatcgcttgccgacgagatcaagcagcgcaccggcgag
gagacgatcacctccgatctcacttacgatctgcgatcgggtgatccggacttcatcgac
aagcttgtggccctgactttcggtaacatggcctacgatgccatgctggaaagcaagtcc
ggcctcatgtcggcgctggtcgagggccgctacgacctcgtccccatccctgacgccaag
cttggtccgcgcaaattggacgttgcgagcagctacaacacggagcgctaccgccccctc
tacgccaataagcaggggctgccgatctttctcaaccgcgcgtcttag

DBGET integrated database retrieval system