KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_69300Help
Entry
BJ6T_69300        CDS       T01848                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BJ6T_69300
Enzymes [BR:bju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BJ6T_69300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7120650..7121555
Genome map
AA seq 301 aa AA seqDB search
MGRVFIAGSINMDVVATADRHPKVGETVAGRQVLYFPGGKGANQAVAASRLGVKTTLIGR
LGKDSFGAELRTFLGAQGIDLGSVRDADTHSGTAIITVAASDNTIVVIPGSNALVGADDV
ADVPLAKGDVAVSQFEIPLPTIAAFFQRAHSAGATTLLNPAPAQKMSSELLALVDILVLN
ETELGFLAGVELAEEDTAARIIEVARKLQARADQTICITLGKRGVLALAGREEFAVPGRA
VKAIDTTGAGDCFVGALASQLASGVQLRAALAFANAAASISVQRMGAGPSMPTAAEVAAV
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggggcgcgtctttatcgccggcagcatcaacatggatgtggtggcgaccgccgatcgc
catcccaaggtcggtgagaccgtcgccggccggcaggtgctgtattttcccggcggcaag
ggcgcgaaccaggccgtcgcggcgtcgcgactcggcgtgaagaccacgctgatcggccgg
cttggcaaggattccttcggcgctgagttgcggacgttcctcggcgcgcagggcatcgat
ctcggctccgttcgggacgccgacacgcatagcggcaccgcgatcatcacggtcgcggcc
tccgacaacaccatcgtcgtcatccccggcagcaatgcgctggtcggcgccgacgatgtc
gcggacgttccgctggcgaagggcgatgtggccgtcagccagttcgagattccgctgccg
acgattgccgccttcttccaacgcgcccatagcgccggcgccacgacgctgctcaacccg
gcacccgcgcaaaagatgtcctccgagctgctggcgctcgtcgacatcctcgtgctgaac
gagaccgagctcggcttcctcgcgggcgtggagcttgcggaggaggatactgcggcgcgc
atcatcgaggtcgcgcgaaaacttcaggcgcgcgcggaccagaccatctgcatcacgctc
ggcaaacgcggcgtgctcgcgctggcaggccgcgaggagttcgcggtgcccggtcgcgcg
gtgaaggcgatcgacaccacaggtgccggagattgttttgtgggcgcgctcgcgtcgcag
cttgcgagcggagtgcaactgcgtgccgcactcgccttcgccaacgcggccgcctcgatc
agcgtgcagcggatgggcgcaggtccctcgatgccgacggctgcggaagtggcggctgtt
ctgtag

DBGET integrated database retrieval system