KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_73810Help
Entry
BJ6T_73810        CDS       T01848                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BJ6T_73810
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BJ6T_73810
Enzymes [BR:bju01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BJ6T_73810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7608918..7610552)
Genome map
AA seq 544 aa AA seqDB search
MNYQPRGISTLQGPASYQSEVEAAQALLKTQPTWNGVSAEAVARMRLQNRFKTGLDIARY
TAALMRADMAAYDNDPTKYTQSLGCWHGFIAQQKLISVKKHFGGKTDRTYLYLSGWMIAA
LRSEFGPLPDQSMHEKTSVPALIEELYTFLRQADSRELNDIFRSLDKARKEGDKTREKEL
IEKIDNFQTHVVPVIADIDAGFGNAEATYLLAKKMIEAGACALQIENQVSDEKQCGHQDG
KVTVPHEVFIAKIRACRHAFLELGVEDGVIVTRTDSLGAGLTQQIAVSHKPGDLGDLYNS
FLDCEEVTAGNARNGDVIINRDGKMMRPKRLPSNLYQFRPGTGEDRCVLDSITSLQNGAD
LLWIETEKPHIEQIAKMVDRIRKVVPNAKLAYNNSPSFNWTINFRWQVYDAMKEAGQDVS
KYNRAELMKPEYDDTPLAKEADERIRTFQADSAKRAGIFHHLITLPTYHTAALSTDNLAK
EYFGDQGMLGYVKNVQRAEIRQGIACAKHQNMAGSDIGDDHKEYFAGEAALKAGGAHNTM
NQFG
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaattaccagccccgtggcatcagcacccttcagggcccggcctcgtatcagagcgag
gttgaggcggcgcaggcgctcctcaagacccagccgacctggaacggggtgtcggccgag
gccgtcgcgcgcatgcggctgcagaaccgcttcaagaccggcctggacatcgcccgctac
accgcggctttgatgcgggccgacatggcggcctatgacaacgatccgaccaagtacacg
cagtcactgggctgctggcacggcttcatcgcccagcagaagctgatctcggtcaagaag
cacttcggcggcaagaccgaccgcacctatctgtacctgtccggctggatgatcgcggcg
ctgcgctcggagttcgggccgctgcccgaccagtcgatgcacgagaagacctcggtgccc
gccctgatcgaggagctctataccttcctgcgtcaagccgactcgcgcgagctgaacgac
atcttccgcagcctcgacaaggcgcgcaaggaaggcgacaagaccagggagaaggagctg
atcgagaagatcgacaacttccagacccatgtcgtgcctgttatcgccgacatcgacgcc
ggcttcggcaacgccgaggcgacctatctgctcgccaagaagatgatcgaagcgggcgcc
tgcgcgctgcagatcgagaaccaggtctcggacgagaagcagtgcggtcaccaggacggc
aaggtcaccgtgccgcacgaggtgttcatcgcgaagatccgcgcctgccgccacgccttc
ctcgagctcggcgtcgaagacggcgtcatcgtgacccgcaccgactcgctcggcgccggc
ctcacgcagcagatcgccgtcagccacaagcccggcgacctcggtgacctctacaacagc
ttcctggattgcgaggaagtcacggccgggaacgcccgcaacggtgatgtcatcatcaac
cgcgacggcaagatgatgcgtccgaagcggctgccgtccaatctctatcagttccgcccg
ggcaccggcgaagaccgctgcgtgctcgacagcatcacctcgctccagaacggcgccgac
ctgctctggatcgagaccgagaagccgcatatcgagcagatcgccaagatggtcgaccgg
atccgcaaggtggttccgaacgcgaagctggcctacaacaactcgccgtcgttcaactgg
accatcaacttccgttggcaggtctacgacgcgatgaaggaagccggccaggacgtcagc
aagtacaaccgcgccgagctgatgaagccggaatacgacgatacgccgctggcgaaggaa
gccgacgagcgcatccgcaccttccaggccgattcagccaagcgcgccggcatcttccat
cacctgatcacgttgccgacctaccacacggcggcgctctcgaccgacaatctggcgaag
gaatatttcggcgaccagggcatgctcggctacgtgaagaacgtgcagcgcgccgagatc
cgccagggcatcgcctgcgccaagcatcagaacatggccggctccgacatcggcgacgac
cacaaggaatacttcgccggcgaggctgccctgaaggcgggcggcgcccacaacacgatg
aaccagttcggctaa

DBGET integrated database retrieval system