KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_74910Help
Entry
BJ6T_74910        CDS       T01848                                 

Definition
chemotaxis two-component response regulator
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bju00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BJ6T_74910
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BJ6T_74910
Enzymes [BR:bju01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BJ6T_74910
Two-component system [BR:bju02022]
 CheA family
  CheA-CheYBV
   BJ6T_74910
Bacterial motility proteins [BR:bju02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BJ6T_74910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7732839..7733930)
Genome map
AA seq 363 aa AA seqDB search
MPREKVRVLIVDDSASVRQILQTILNDDPDIEVMGAASDPFAAARRLQNEIPDVMILDLE
MPRMDGMTFLRKIMAQRPIPVIICSSLTEEGSNVMFEAFEAGAVDIVPKPKIDTRQALLE
CSTRLREAVKSAARARVRPRAERRTIERKLTADAIIPPPVQGKVRPTTERIVCIGASTGG
TEALNDVLEMLPPHCPPIVIVQHMPAGFTAAFARRLDSVCQVRVKEAEDGEPVLPGCAYI
APGARHMLLQRIGLRYQIAIKDGPPVSRHRPSVDVLFRSAAQHAGANALGVIMTGMGDDG
ARGMLEMRKLGASTRAQNEESCVVFGMPKEAIAHGGVEKVVSLHHIPREIMLWYQAGHVA
VAG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgccgagggagaaagttcgcgtactgatcgtggacgattcggcgtcggtgcgccaaatc
ctgcaaacgatcctcaacgacgatcctgacatcgaggtgatgggggctgcctccgatccg
ttcgcggcggcgcgccggctgcagaacgaaatccccgatgtcatgatcctcgacctggaa
atgccgcgcatggacggcatgaccttcctgcgcaagatcatggcgcagcgcccgatcccg
gtgatcatctgctcctcgctcaccgaggaaggttccaacgtgatgttcgaggcgttcgag
gcgggcgcggtcgacatcgtgccgaagccgaagatcgacacccggcaggcgctgctcgaa
tgctcgacgcggctgcgcgaggccgtgaaatcggcagcgcgcgcgcgggtgcgcccgcgg
gcggagcgccgtacgatcgagaggaagctgaccgccgacgccatcatcccgccgccggtg
cagggcaaggtccggccgaccactgagcgcatcgtgtgcatcggcgcatcgaccggcggc
accgaagcgctcaacgacgtcctcgagatgctgccgccgcactgtcctcccattgtcatc
gtccagcacatgccggcagggttcaccgcggccttcgccaggcgtctcgacagcgtctgc
caggtccgcgtcaaggaagccgaggacggcgagccggtgctgccgggctgcgcctatatc
gcgccgggcgcccgccacatgctgctccagcgcatcggcctgcgctaccagatcgcgatc
aaggacggcccgccggtgtcgcggcatcgcccctcggtcgacgtgctgtttcgctccgcg
gcccagcatgccggcgccaacgcgctcggcgtgatcatgacgggcatgggcgacgacggc
gcgcgcggcatgctggagatgcgcaagctcggcgcctcgacacgcgcgcagaacgaggag
agctgcgtggtgttcggcatgcccaaggaagcgatcgcgcatggcggtgtcgagaaggtc
gtctcgctgcatcatatcccgcgcgagatcatgctctggtatcaggccggacacgttgcg
gtggcaggttga

DBGET integrated database retrieval system