KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_76010Help
Entry
BJ6T_76010        CDS       T01848                                 

Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bju  Bradyrhizobium japonicum USDA 6
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7849752..7850819
Genome map
AA seq 355 aa AA seqDB search
MTRLDRREFLLGSAVALAAGASASAAPASKLAQRRPGFGAAATLWDLQADPRLGEAISTY
CTQVVPVLELKWPMLRPNAHTFNFERADAILDFARENDLTMRGHALAWYHDIPDWTKQIK
DTKGVERAYVDHIGTVVSYYKDKLTSWDVVNEPIPDNPKKITDRRDTFWTQHLGNRWIPL
AFRTAAAADPFVKLAINEYDIESAKDSFIAKRAAYRNLIMDLLDQGVPLHAVGLQSHLHA
ELDIDTHGLAEFVTELRSWGLDVLVTELDVDDQKLTGNPAERDAIVAKRVDDLLTAISTS
GPVRSILTWGLSDRYSWINGTFARADKQPNRPLPLDGEFKPKPFMDVISKFTRDA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaggctcgacagacgcgaatttctcctcggcagcgccgtagcactcgcggcgggg
gcatcggcgtccgccgcgccggcatcaaaactcgcgcagcgccgtccgggctttggcgct
gcggcgacgctctgggacctgcaagccgatccgaggctcggcgaagccatcagcacctat
tgcacccaggtggtgccggtgcttgagctgaaatggccgatgctgcggccgaacgcgcac
acgttcaacttcgagcgcgccgacgcgatcctggatttcgcgcgggagaacgatctgacg
atgcgcggccacgcgctcgcctggtatcacgacattccggactggaccaagcagatcaag
gacaccaagggcgtcgagcgcgcctatgtcgaccacatcggcaccgtcgtgtcctattac
aaggacaagctgacgtcatgggacgtcgtcaacgagccgatcccggacaatccgaagaag
atcaccgaccggcgcgatacgttctggacgcagcatctgggcaatcgctggatcccgctg
gccttccgcacggcggctgcagccgatcccttcgtcaagctcgcgatcaacgaatatgac
atcgagtcggcgaaggactcgttcattgccaagcgcgcggcgtaccgcaacctcatcatg
gacctgctcgaccagggcgtgccgctgcacgccgtgggcctgcaatcgcatctgcacgcc
gagctcgatatcgacacgcatgggctcgccgaattcgtcaccgagctgcgctcctggggc
ctcgatgtgctcgtcaccgagctcgatgtcgacgaccagaaactgacgggcaacccggca
gagcgcgacgccatcgtcgccaagcgcgtcgacgacctcctgaccgcgatctcgaccagc
gggccggtgcgctcgatcctgacctggggcctctcggatcgctatagctggatcaacggc
accttcgcccgcgcggacaagcagccgaaccgcccgttgccgctcgacggcgagttcaag
ccgaagccgttcatggacgtcatcagcaagttcacgagggacgcctga

DBGET integrated database retrieval system