KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_76600Help
Entry
BJ6T_76600        CDS       T01848                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BJ6T_76600
Enzymes [BR:bju01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     BJ6T_76600
Transfer RNA biogenesis [BR:bju03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    BJ6T_76600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7916122..7916952
Genome map
AA seq 276 aa AA seqDB search
MQVKRIIDGPAASHLMEPLTALVVRAGEAILAVNRAAMRVDGKQDGSPVTEADLAADRVI
ADGLARLAADVPTLSEERTQLASPPFRDSFFLIDPLDGTKEFVAGRDEFTVNLALVTKGV
PLLGIVAAPALGLLWRGIVGRGAERVRFDGTSIGAAEPVRTRTLPTQGEPWIAAVSRSHG
DLRSEAFIDGRPNAVRKTVGSAVKFGRIAEGSADIYPRFGPTCEWDVGAGCAVVTAAGGK
VTDGKGGELRFGQRGDTGFIIPEFIAWGDPRAAGCY
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgaagcgaatcatcgacggcccggccgcctcccacttgatggagccgctcacc
gcgctggtggtgagggcgggcgaagcgatcctcgcggtcaaccgggcagcgatgcgggtc
gacggcaagcaggacggctcgccggtcaccgaggccgatctcgccgccgaccgcgtcatc
gctgacggcctggcgcggcttgcggccgacgtgccgacgctgtcggaagagcggacccag
ctcgcctcgccgccattccgcgacagcttcttcctgatcgacccgctcgacggcaccaag
gagttcgtcgccggccgcgacgagttcaccgtcaacctcgccctcgtgaccaaaggcgtg
ccgttgctgggcatcgtagccgcgcccgcgctcggcctgctctggcgcggcatcgtcggc
cgcggcgccgagcgcgtcaggttcgacggcacgagcatcggtgctgccgaaccggtccgc
acccgcacgctgccgacgcagggcgagccctggatcgcggcggtgagccgatcccatggc
gacctcaggagcgaagcgttcatcgacggccggcccaatgcggtcaggaagacggtcggc
tcggcggtgaaattcggccggatcgcggagggcagcgccgacatctatccccgcttcgga
cccacttgcgaatgggatgtcggggcgggctgcgcggtcgtgacggcggccggcggcaag
gtcaccgacggcaagggtggcgagctccgattcggccagcgcggcgacaccggcttcatc
atcccggagttcatcgcctggggcgatccgcgggcggcaggctgctactga

DBGET integrated database retrieval system