KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_78560Help
Entry
BJ6T_78560        CDS       T01848                                 

Definition
hypothetical protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BJ6T_78560
   00500 Starch and sucrose metabolism
    BJ6T_78560
Enzymes [BR:bju01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     BJ6T_78560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8121435..8122475)
Genome map
AA seq 346 aa AA seqDB search
MRIFVSSAALLAGCFCIAAAYAHPLLVSHAGNADYHSVQQAIDALPAEGGNVRIAPGIYR
EKVKITKSGVHLAGTGNKPEDTVIVYGDGAVNVGGTARSATLDAPSDDFRLENLTIQNDY
ALNPANPPSQAVALSVTGDRDVITRVRLLGAQDTLFAGKGPNGRMSRQYFSNCYIEGHVD
FIFGNAKVWFRQCELHGIANQAVIYTAQSKATPDEDSGYVFDHCRLSADPAARYIALGRP
WRSYATVVFLSTKIDARVIAEGWREWAPGETNKLSTSYYAEYRSFGIGANPSGREPHSHQ
LKDGEAARWSLRVFFAGVTDWLPTNHQVRTKSNVHGEGVPRRSSDE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattttcgtttcctccgctgcacttctggcgggatgtttctgcatcgccgcggcg
tacgctcatccactgttggtgtcgcatgccggaaatgcagactatcactccgtgcagcaa
gccatcgacgcattgccggcggaaggcggaaacgtccggatcgcgccaggcatctatcgc
gagaaggttaaaatcacgaaatccggtgttcatctcgcagggactggcaacaagccggag
gatacggtcattgtgtatggcgacggcgcggtcaatgtaggaggaacggcccgttcggcg
acgctggatgcccctagcgatgacttccggctcgagaatctgaccattcagaacgactat
gccctcaatccggccaatccaccttcgcaggcggtagcgctgtccgttaccggagatagg
gacgtcattacgcgcgtccgcctgctcggcgcccaggacacgctgtttgccggcaaggga
ccaaacggtagaatgtcacgacaatacttctcgaactgctacatcgaagggcatgtcgat
ttcatatttggcaacgccaaggtctggttccggcaatgtgaattgcacggcatcgccaat
caagcggtcatctataccgctcagagcaaggcaacgccggatgaggacagtggctatgtt
tttgatcattgcaggctaagtgccgaccctgctgcgcgctatatcgcgcttggccgcccc
tggcgctcctacgccacagtggtcttcctgtcgacaaagatagatgcacgagtgattgcg
gaaggctggcgcgaatgggctcccggcgagaccaacaagttgagcacgagctattatgcc
gaatatagatccttcggcatcggtgctaacccatcaggccgcgagcctcattcccatcaa
ctgaaagatggcgaagctgcgagatggtcgctgagagtgttcttcgcgggtgtcacagat
tggctgcccacgaaccatcaggttcgaacaaagagcaatgttcacggtgaaggggttcca
cggcgatcctcggatgaatga

DBGET integrated database retrieval system