KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_82960Help
Entry
BJ6T_82960        CDS       T01848                                 

Definition
methylamine utilization protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bju  Bradyrhizobium japonicum USDA 6
Brite
Enzymes [BR:bju01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     BJ6T_82960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8598475..8599497)
Genome map
AA seq 340 aa AA seqDB search
MRIWVSLALLAALFPLGQPFASAAAETSADATARASYRRPAAIPFPDRNPYTVPKAALGE
RLFFDALLSKSRTRSCATCHNPSLSWGDGLARAVGEDPSGLPLRAPTLIDVAFTEPLGWD
GKFKTLEAVTFGPITGRANMNLTESELIARLSAIPAYADAFAAAFGDGAITRPRIEAALA
TFERTIVAGEAPFDRWIMGDVTSVSAAAKRGFEIFNGKAHCSNCHSGPSFTDGSFHDIGV
ARNDDVGRGRLFPTSQKLRYAFKTPTLRDVARRAPYMHDGSVATLEEVIELYDKGGIDRP
SRSPSIEPLSLTESEKADLIAFLQTLTASSTDTTFPRLAR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaggatctgggtcagcttagctttgctcgcggccctttttccgctgggccaacctttt
gcctcggcagcggcggagacatcagcggatgccacggcgcgcgccagctatcgtcggccg
gcggcgatcccttttcccgatcgtaatccctacacggtgccgaaagctgctctcggggaa
agactcttcttcgatgcgctgctctcgaagtcccgcacccgttcctgcgcaacgtgccac
aatccgtcgctttcctggggtgatggcctcgcgcgtgcggtcggcgaggatcccagcggc
ctgccattgcgtgcgccgaccctgatcgacgtggcgttcaccgaaccgttggggtgggac
ggcaaattcaagactctcgaagccgtcacgttcgggccgatcacaggccgggccaacatg
aatttgacggaatcagaattgatcgcgcgtctctccgctatcccggcctatgctgatgca
ttcgcagccgcattcggggacggtgcgatcacgcgacccaggatcgaagccgcgttggcg
acttttgaacgaaccatcgtggctggcgaagcgccattcgaccggtggatcatgggagac
gtgacatccgtcagcgccgcggcaaaacgcggctttgagattttcaacggcaaagcccat
tgctcaaactgccacagtggaccatcgttcactgacggatcgtttcacgatattggcgtc
gcaaggaacgacgacgttggacgcggtcggctttttccgacgtcgcaaaagctgcggtac
gcattcaaaacgccgacactgcgcgatgtcgcgcggcgtgctccctacatgcatgatgga
tcggtcgcaaccctcgaagaggtcatcgaactctatgacaagggtgggattgaccgtccg
agccgctcgccttcaatagagcctctatctctgacggaaagcgaaaaggcggatctgatc
gcttttcttcagacgctcaccgcatcctcgacggatacgacttttcccaggttggcgcga
tga

DBGET integrated database retrieval system