KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_83710Help
Entry
BJ6T_83710        CDS       T01848                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BJ6T_83710
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BJ6T_83710
   00630 Glyoxylate and dicarboxylate metabolism
    BJ6T_83710
Enzymes [BR:bju01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BJ6T_83710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8678788..8680953
Genome map
AA seq 721 aa AA seqDB search
MKRVDAHGLKIAPVLFDFIAKEAAPKTGIAPDAFWAGVAAIVKELGPKNRALLAVRDTLQ
AKIDDWHRANKGKAFDLDAYTAFLKEIGYLVPEPATQKVETANVDEEIGKICGPQLVVPL
TNARYALNAANARWGSLYDAFYGTDAIPHDAAESGKGYNKARGDKVIAKAKAFLDAAVPL
ATGSHTDVTAYGVVAGQLAVKLKSGNATALKNADQFAGFQGDAAAPSAVLLANNGLHVEV
KIDRSSTIGKDDPAGVADMVMEAAVSTILDMEDSVAAVDAEDKVLVYRNTLGLMNGTLSA
DFEKGGKTLTRSLNADRSYKTPDGKGEVKLHGRSLLLMRNCGHHMFTDAVLDDKGEEVPE
GLLDAAVSGLLAIHDLKGNAKVKNSRTGSAYIVKPKMHGPDEVSLACEIFDRVEKMLGLP
ENTLKVGIMDEERRTTVNLKACIQRASKRIMFINTGFLDRTGDEIHTSMEAGPMIRKNEM
KAQAWIKAYEDWNVDMGLIDGLPGHAQIGKGMWAAPDKMADMLQQKLAHPQAGATTAWVP
SPTAATLHALHYHQVNVTARQQELTKGGPRAKLSDILTIPVSKSNWAPDDVKQEIDNNCQ
GILGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHLANWLHQGVITEAQVMESLK
RMAVVVDKQNAGDAIYKPMAPAFDGVAFKAACDLIFKGREQPNGYTEYILTARRREAKAV
G
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcgtcgacgcccacggattgaagatcgctcccgtccttttcgatttcatcgcc
aaggaagccgccccgaaaacggggatcgcgccggacgcgttctgggccggggtcgccgcc
atcgtcaaggagctggggccgaagaaccgcgcgctgctggcggtgcgggacacgctgcag
gccaagatcgacgactggcaccgcgccaacaagggcaaggcgttcgacctcgacgcctat
accgccttcctgaaggagatcggctatctcgtccccgagccggcgacgcagaaggtcgag
accgccaatgtcgatgaggaaatcggcaagatctgcggcccgcagctcgtcgtccccctc
accaatgcgcgctacgcactgaacgcggcgaatgcgcgctggggctcgctctacgacgcc
ttctacggtaccgacgcgatcccgcacgacgctgccgagagcggcaagggctacaacaag
gcgcgcggcgacaaggtgatcgcgaaggccaaggcattcctcgatgccgccgtgccgctc
gcgaccggcagccacaccgacgtcaccgcctatggcgtggtcgcaggccagctcgcggtg
aagctgaagagcggcaacgccaccgcgctgaagaacgcggatcaattcgcgggcttccag
ggtgatgcggccgcgccgagcgccgtgctgctcgccaacaacggcttgcacgtcgaggtc
aagatcgaccgcagcagcacgatcggcaaggacgatcccgccggcgtcgccgacatggtc
atggaggccgcggtctcgaccatcctcgacatggaggactcggtcgccgcggtcgacgcc
gaggacaaggtgctggtctatcgcaacacgctcggcctgatgaacggtacgctctcggcc
gatttcgagaagggcggcaagacgctgacccgttcgctcaacgccgaccgcagctacaag
acgcctgacggcaagggcgaggtcaagctgcacggccgcagcctgctcttgatgcgcaat
tgcggtcaccacatgttcaccgacgcggtgctggacgacaagggcgaggaagtcccggaa
ggcctgctcgacgccgccgtctccggcctgcttgcgatccacgacctcaagggcaacgcc
aaggtcaagaacagccgcaccggatctgcctatatcgtcaagccgaagatgcacggtccg
gacgaggtctcgctggcctgcgagatctttgaccgcgtcgagaagatgctgggcctgccg
gagaatacgctcaaggtcggcatcatggacgaggagcggcgcaccaccgtcaacctcaag
gcctgcatccagcgcgcctccaagcgcatcatgttcatcaacaccggcttcctcgatcgc
accggcgacgagatccacacctcgatggaagcgggcccgatgatccgcaagaacgagatg
aaggcgcaggcctggatcaaggcctatgaggactggaacgtcgacatgggcctgatcgac
ggcctgcccggccatgcccagatcggcaagggcatgtgggcggcgcccgacaagatggcg
gacatgctgcaacagaagctcgcgcatccgcaggccggcgccaccaccgcctgggtgccc
tcgccgaccgctgcgacgctgcacgccctgcactatcaccaggtcaacgtcaccgcgcgc
cagcaggagctcaccaagggcggcccgcgcgcaaagctctccgacatcctcaccatcccg
gtgtcgaagtcgaactgggcgcccgacgacgtcaagcaagagatcgacaacaactgccag
ggcattctgggctatgtcgtgcgctggatcgaccagggcgtcggctgctccaaggtgccc
gatatccacgatgtcggcctgatggaagaccgcgccaccttgcgcatctccagccagcat
ctcgccaactggctgcaccagggcgtgatcaccgaggcgcaggtgatggaatcgctcaag
cgcatggccgtcgtggtcgacaagcagaacgccggcgatgcgatctacaagccgatggcg
cccgccttcgacggtgtcgcgttcaaggcggcctgcgacctgatcttcaagggacgcgaa
cagccgaacggctacaccgagtacatcctcactgcccgccgccgcgaggccaaggctgtg
ggctaa

DBGET integrated database retrieval system