KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_84240Help
Entry
BJ6T_84240        CDS       T01848                                 

Definition
cytochrome C
Orthology
K08738  
cytochrome c
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BJ6T_84240
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BJ6T_84240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8734663..8735217)
Genome map
AA seq 184 aa AA seqDB search
MDSFELNKILGAVLGTCLILLVTSFTAQALFTPKPLEKPGFEIVVKEDAGHGKEGGAAAA
ASEPIEKLLQTASVEKGAAAAKKCGACHTFEKGGPNRVGPNLYGVVGEARGEGRNGFNFS
AAMKAKGGTWSFDDLNKFIANPKGFIPGTAMGFAGIPKDSERADVIAYLNSLSEHPQPIP
TASK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggactctttcgaactcaataagattctcggtgccgtgttgggcacctgtctcatcctg
ctggtgacgagcttcaccgcccaggcgctgttcacgccgaagccgctcgagaagccgggt
ttcgaaattgtcgtgaaggaagacgccggccacggcaaggaaggcggcgccgctgccgct
gcctccgagccgatcgaaaagctgctccagaccgcctccgtcgagaagggcgcggcggcc
gccaagaagtgcggcgcctgccacaccttcgagaagggcggcccgaatcgcgtcggtccg
aacctctatggcgtcgtcggcgaagccaggggcgagggccgcaacggcttcaacttctcg
gccgccatgaaggccaagggcggcacctggtcgttcgacgacctcaacaagttcattgcg
aaccccaagggcttcatcccgggcaccgcgatgggctttgccggcatcccgaaggactcc
gagcgcgccgacgtcatcgcctatctgaattcgctgtcagagcatcctcaaccgatcccg
acggcgtcgaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system