KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_84370Help
Entry
BJ6T_84370        CDS       T01848                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BJ6T_84370
Enzymes [BR:bju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BJ6T_84370
Exosome [BR:bju04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BJ6T_84370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8753527..8755032)
Genome map
AA seq 501 aa AA seqDB search
MSFVLAIDQGTTSSRAIVFRSDISIAARAQQEFPQHFPASGWVEHEPEDIWTSTVMVCRD
AIEQAGITAKDIAAIGITNQRETTVVWDRATGQAVHRAIVWQDRRTADICAKLKAEGREP
VISQKTGLIIDPYFSGTKVAWILDHVPGARARAARGELMFGTVDCYLLWRLTGGKVHATD
ATNASRTLLFNIHTGQWDDELLEIIGVPRSMLPEVKDSSARFGESTPDLFGGAIAISGIA
GDQQAATIGQACFRPGMMKSTYGTGCFALLNTGTTPVVSKNKLLTTVAYQLDGKRTYALE
GSIFVAGSAVQWLRDGLGIIKHAAETGPLADQSDSMQSVYLVPAFVGMGAPYWNPRVRGA
LFGLTRNTGPAELAHAALESVCYQTFDLWAAMRADWPSSEVASVVLRVDGGMTASDWTMQ
RLADLLDAPVDRPVIQETTALGAAYLAGLQAGVYPEPTKFADNWRLEHRFKPNMSQATRE
RKLAGWARAVKGVLASDEGEG
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcgtcctcgccatcgaccagggcaccacctcgtcgcgcgccatcgtttttcgc
agtgacatctcgattgccgcccgcgcgcagcaggagtttccgcagcattttccggcctcg
ggctgggtcgagcacgagccggaggacatctggacctcgaccgtgatggtctgccgcgac
gcgatcgagcaggccggcatcaccgcaaaggacatcgccgcgatcggcatcaccaaccag
cgcgagaccaccgtggtgtgggaccgcgccacgggccaggccgtgcaccgcgccatcgtc
tggcaggaccgccgcaccgccgacatctgcgcgaaattgaaagcagaaggccgcgagccc
gtgatctcgcagaagaccggcctgatcatcgatccctatttctcgggcaccaaggtcgcc
tggatcctcgaccacgttcccggcgcacgggcgcgggccgcgcgcggcgaattgatgttc
ggcaccgtcgactgctatctgctctggcgcctcaccggcggcaaggtgcacgccaccgac
gccaccaacgcctcgcgcacgctgctgttcaacatccacacgggccagtgggacgacgag
ctcttggagatcatcggcgtgccgcgctcgatgctgcccgaggtgaaggattcctccgcc
cgcttcggcgagagcacgccggacctgttcggcggcgcgatcgcgatctcaggcattgcc
ggcgaccagcaggccgcgaccatcggccaggcctgtttccgaccgggcatgatgaagtcc
acctacggcaccggctgctttgccctgctcaacaccgggaccacgccggtcgtctccaag
aacaagctgctcaccaccgtcgcctatcagctcgacggcaagcgcacctacgccctcgaa
ggctcgatcttcgtcgcaggctcggcggtgcagtggctgcgcgacggcctcggcatcatc
aagcacgctgccgagaccggacctcttgctgatcagtcggactccatgcagagcgtctat
ctggtccccgccttcgtcggcatgggcgcgccctactggaatccgcgggtgcgcggcgcg
ctgttcggcctcacccgcaacaccggcccggcggagctcgcgcacgccgcgctggagagc
gtgtgttaccagaccttcgacctctgggccgcgatgcgcgcggactggccgagctcggaa
gtcgcgagcgtcgtgctgcgcgtcgacggcggcatgaccgcctccgactggaccatgcag
cgcctcgccgatctcttggacgcaccggtcgatcggcccgtgatccaggagaccacggcg
ctgggcgctgcgtacctcgccggcctccaggccggcgtctatcccgagccgacgaagttc
gccgacaattggcgcctcgagcatcgcttcaagccgaacatgagccaggcgacgcgggag
cggaagctcgcgggttgggcgagggcggtgaagggcgtgctcgcgagcgacgagggggag
ggatag

DBGET integrated database retrieval system