KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_84370Help
Entry
BJ6T_84370        CDS       T01848                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bju00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8753527..8755032)
Genome map
AA seq 501 aa AA seqDB search
MSFVLAIDQGTTSSRAIVFRSDISIAARAQQEFPQHFPASGWVEHEPEDIWTSTVMVCRD
AIEQAGITAKDIAAIGITNQRETTVVWDRATGQAVHRAIVWQDRRTADICAKLKAEGREP
VISQKTGLIIDPYFSGTKVAWILDHVPGARARAARGELMFGTVDCYLLWRLTGGKVHATD
ATNASRTLLFNIHTGQWDDELLEIIGVPRSMLPEVKDSSARFGESTPDLFGGAIAISGIA
GDQQAATIGQACFRPGMMKSTYGTGCFALLNTGTTPVVSKNKLLTTVAYQLDGKRTYALE
GSIFVAGSAVQWLRDGLGIIKHAAETGPLADQSDSMQSVYLVPAFVGMGAPYWNPRVRGA
LFGLTRNTGPAELAHAALESVCYQTFDLWAAMRADWPSSEVASVVLRVDGGMTASDWTMQ
RLADLLDAPVDRPVIQETTALGAAYLAGLQAGVYPEPTKFADNWRLEHRFKPNMSQATRE
RKLAGWARAVKGVLASDEGEG
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcgtcctcgccatcgaccagggcaccacctcgtcgcgcgccatcgtttttcgc
agtgacatctcgattgccgcccgcgcgcagcaggagtttccgcagcattttccggcctcg
ggctgggtcgagcacgagccggaggacatctggacctcgaccgtgatggtctgccgcgac
gcgatcgagcaggccggcatcaccgcaaaggacatcgccgcgatcggcatcaccaaccag
cgcgagaccaccgtggtgtgggaccgcgccacgggccaggccgtgcaccgcgccatcgtc
tggcaggaccgccgcaccgccgacatctgcgcgaaattgaaagcagaaggccgcgagccc
gtgatctcgcagaagaccggcctgatcatcgatccctatttctcgggcaccaaggtcgcc
tggatcctcgaccacgttcccggcgcacgggcgcgggccgcgcgcggcgaattgatgttc
ggcaccgtcgactgctatctgctctggcgcctcaccggcggcaaggtgcacgccaccgac
gccaccaacgcctcgcgcacgctgctgttcaacatccacacgggccagtgggacgacgag
ctcttggagatcatcggcgtgccgcgctcgatgctgcccgaggtgaaggattcctccgcc
cgcttcggcgagagcacgccggacctgttcggcggcgcgatcgcgatctcaggcattgcc
ggcgaccagcaggccgcgaccatcggccaggcctgtttccgaccgggcatgatgaagtcc
acctacggcaccggctgctttgccctgctcaacaccgggaccacgccggtcgtctccaag
aacaagctgctcaccaccgtcgcctatcagctcgacggcaagcgcacctacgccctcgaa
ggctcgatcttcgtcgcaggctcggcggtgcagtggctgcgcgacggcctcggcatcatc
aagcacgctgccgagaccggacctcttgctgatcagtcggactccatgcagagcgtctat
ctggtccccgccttcgtcggcatgggcgcgccctactggaatccgcgggtgcgcggcgcg
ctgttcggcctcacccgcaacaccggcccggcggagctcgcgcacgccgcgctggagagc
gtgtgttaccagaccttcgacctctgggccgcgatgcgcgcggactggccgagctcggaa
gtcgcgagcgtcgtgctgcgcgtcgacggcggcatgaccgcctccgactggaccatgcag
cgcctcgccgatctcttggacgcaccggtcgatcggcccgtgatccaggagaccacggcg
ctgggcgctgcgtacctcgccggcctccaggccggcgtctatcccgagccgacgaagttc
gccgacaattggcgcctcgagcatcgcttcaagccgaacatgagccaggcgacgcgggag
cggaagctcgcgggttgggcgagggcggtgaagggcgtgctcgcgagcgacgagggggag
ggatag

DBGET integrated database retrieval system