KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_87130Help
Entry
BJ6T_87130        CDS       T01848                                 

Definition
enoyl-CoA hydratase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BJ6T_87130
   01212 Fatty acid metabolism
    BJ6T_87130
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BJ6T_87130
   00650 Butanoate metabolism
    BJ6T_87130
  Lipid metabolism
   00071 Fatty acid degradation
    BJ6T_87130
   01040 Biosynthesis of unsaturated fatty acids
    BJ6T_87130
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BJ6T_87130
   00310 Lysine degradation
    BJ6T_87130
   00380 Tryptophan metabolism
    BJ6T_87130
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BJ6T_87130
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BJ6T_87130
   00281 Geraniol degradation
    BJ6T_87130
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BJ6T_87130
Enzymes [BR:bju01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BJ6T_87130
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BJ6T_87130
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BJ6T_87130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9040478..9042691
Genome map
AA seq 737 aa AA seqDB search
MAYKNFKVETDSDGIALVTWDIPGRSMNVLDETSTSELDAIVKETTADAAVKGVVITSAK
EAFCAGADLSMLEGMNQAYAKVLKEQDETAANQMLFDQSRRFSQVLRSIETSGKPWAAAI
NGLALGGGFEITLCCHYRVAAENPKTRLGLPEVKVGLFPGAGGTQRVPRLVPPQDAMTIL
LKGDPVTVEKAKALNLIHAIVPAADLVKAAKDWIKGGGKAVAPWDEKGFKLPGGPVFSKA
GMMMFPAGNAIYRRETYDNYPAARAIMSCVYEGLQLPIDAALRVESRYFTSVLRSKEAAA
MIRSLFLSMQELNKGARRPKDVAPTKVKKIAVIGAGFMGASVGYVSARAGLDVVLIDRDQ
ESADKGKAHAQKVIEEQIKKGRAKPGDAEALLARITPTADYAALKDVDLVIEAVFEDRKV
KAETFAKAQEYLKPDVIFASNTSTLPITSLAEGFKEQGKFVGIHFFSPVEKMMLVEIIKG
KNTGDVALATALDYVRQIGKTPIVVNDSRGFFANRCVGRYVAEGNEMFLEGVPPAMIENC
AKMAGMPVGPLSLSDEVALDLGLKIMKATEADLGPNAINPDQKKLMVEMVENQGRLGRKN
SKGFYDYPEKGKGQKSLWPGLSALQPKQLDPDTLDIEELKQRFLVVQAVEAARTVEDHVI
TDPREADVGSILGFGFAPFTGGTLSYIDFMGTKKFVELCHKLEAKYGSRFTPPKLLEEMA
AKGETFYGRFAPKKAAA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atggcttacaagaacttcaaggttgagaccgattccgacggcatcgcgctcgtcacctgg
gacatcccgggccgttcgatgaacgtgctagacgagacctcgaccagcgagctcgatgcg
atcgtcaaggagaccacggccgacgccgccgtgaagggcgtcgtcatcacctccgccaag
gaggcgttctgcgccggcgccgatttgtcgatgctcgagggcatgaaccaggcctacgcc
aaggtcttgaaggagcaggacgagaccgccgcgaaccagatgctgttcgaccagagccgg
cgcttctcgcaggtgctgcgctcgatcgagacctccggcaagccgtgggcggccgcgatc
aacggcctcgcactcggcggcggtttcgagatcacgctgtgctgccactatcgcgtggcg
gcggaaaatcccaagacgcgcctcggcctgcccgaggtcaaggtcggcctgttccccggc
gccggcggcacgcagcgcgtgccgcgcctggtgccgccgcaggacgcgatgacgatcctg
ctcaagggcgatccggtcacggtcgagaaggccaaggcgctgaacctcattcacgcgatc
gtccctgcggcagatctcgtcaaggcagcgaaggactggatcaagggcggcggcaaggcc
gtcgcgccctgggacgagaagggcttcaagctgccgggcggtccggtgttctccaaggcc
ggcatgatgatgttcccggccggcaacgcgatctatcgccgcgagacctacgacaattat
ccggccgcgcgcgcgatcatgagctgcgtctatgaaggcctgcagctgccgatcgatgcg
gcgctgcgcgtcgagtcgcgctacttcacctcggtgctgcgttcgaaggaagcagccgcg
atgatccgcagcctgttcctgtcgatgcaggagctcaacaagggtgcgcgccgtccgaag
gacgtagccccgaccaaggtgaagaagatcgccgtgatcggcgccggcttcatgggtgcg
agcgtcggctacgtctcggcccgtgccggcctcgacgtcgtcctgatcgaccgcgaccaa
gagagcgccgacaagggcaaggcgcatgcgcagaaggtgatcgaggagcagatcaagaag
ggccgcgccaagccgggtgatgccgaagcgctgctcgcgcgcattacgccgactgcggac
tatgcggcactgaaggacgtcgacctcgtcatcgaggccgtgttcgaggatcgcaaggtc
aaggctgagacgtttgccaaggcgcaggaatatctgaagccggacgtgatcttcgcgtcg
aacacctcgacgctgccgatcacctcgctggccgagggtttcaaggaacagggcaagttc
gtcggtatccacttcttctcgccggtcgagaagatgatgctggtcgagatcatcaaaggc
aagaacaccggcgacgtcgcgctcgcgaccgcgctcgactacgtccggcagatcggcaag
acgccgatcgtcgtcaacgacagccgcggcttcttcgccaatcgctgcgttggccgctac
gtcgccgaaggcaacgagatgttcctggagggcgtgccgccggcgatgatcgagaactgc
gccaagatggccggcatgccggtcggtccgctctcgctctcagacgaagtcgcactcgac
ctcggcctcaagatcatgaaggcgacggaagccgatctcggcccgaacgccatcaacccc
gatcagaagaagctgatggtggagatggtcgagaaccagggccgtctcggccgcaagaac
agcaagggcttctacgactaccccgagaagggcaagggtcagaagagcctgtggccaggg
ctgtcagcgctgcagccgaagcagctcgaccctgacacgctcgacatcgaggagctgaag
cagcgcttcctggtggtgcaggctgtggaagccgcgcgcacggtcgaggaccacgtcatc
accgacccgcgcgaggcggatgtcggctcgatcctcggcttcggcttcgcgccgttcacc
ggcggcacgctgtcctacatcgacttcatgggcacgaagaaattcgtcgagctctgccac
aagctggaggcgaagtacggctcgcgtttcaccccgccgaagcttctcgaggagatggcc
gcgaagggagaaaccttctacggccgcttcgcgccgaagaaggccgcggcctga

DBGET integrated database retrieval system