KEGG   Bacillus krulwichiae: BkAM31D_16410Help
Entry
BkAM31D_16410     CDS       T04947                                 

Gene name
thlA_2
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bkw  Bacillus krulwichiae
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:bkw00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BkAM31D_16410 (thlA_2)
   00630 Glyoxylate and dicarboxylate metabolism
    BkAM31D_16410 (thlA_2)
   00640 Propanoate metabolism
    BkAM31D_16410 (thlA_2)
   00650 Butanoate metabolism
    BkAM31D_16410 (thlA_2)
  Lipid metabolism
   00071 Fatty acid degradation
    BkAM31D_16410 (thlA_2)
   00072 Synthesis and degradation of ketone bodies
    BkAM31D_16410 (thlA_2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BkAM31D_16410 (thlA_2)
   00310 Lysine degradation
    BkAM31D_16410 (thlA_2)
   00380 Tryptophan metabolism
    BkAM31D_16410 (thlA_2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BkAM31D_16410 (thlA_2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BkAM31D_16410 (thlA_2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BkAM31D_16410 (thlA_2)
Enzymes [BR:bkw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BkAM31D_16410 (thlA_2)
Exosome [BR:bkw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BkAM31D_16410 (thlA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2999521..3000711)
Genome map
AA seq 396 aa AA seqDB search
MSERVFVVSAQRTAVGKLGGTLKHMEPDNLLLPLYKDLIEKQLVFDELNEVIIGQAKQSQ
DQSNIARQSLLKAGLPERLPGYTVHRQCGSGMQAIQNGFLAIRSGYGDAYIVGGVESMST
APYYIRNARYGFLSGHSEILDPNKSSQPGSQPVEKYGQLVMGMTAENLAEDHQISRMEQD
EFALVSQLKANLAIKSKTFKEEIVPIHVPQKKGEPIIFDTDEHPRQTTLEKLESLKPVFK
ENGTVTAGNSSGLNDGASMLLVVSEKKVKQYQLKPLVEIVSLGVSGVKPDRMGIGPVEAT
KQALTLADIDINDIDLVELNEAFAAQALAVIKELNLPQDKVNINGGAIALGHPIGNTGSR
ICVTLIHSMLKQKAKWGLATLCIAGGQGISTIFKTV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaagagtatttgtagtaagtgcccaaaggactgccgttggaaagctaggagga
actttaaagcacatggaaccagacaatttgcttcttcctctttataaagatttaatagag
aaacaattggtttttgatgaattaaatgaggttattatagggcaagccaaacaaagccag
gatcaatccaatattgctaggcaatcactacttaaagcgggtctgccagagcgtttacca
ggatacacagttcatcgtcaatgtggttcagggatgcaggcaattcaaaatggttttcta
gcgattcgatctggctatggtgatgcttatatagttggtggtgttgaaagtatgagcaca
gcaccttactatatccgcaatgcaaggtatgggtttttatcaggtcattcagagatttta
gacccaaataaatccagccagccggggtcacagcccgttgagaaatacggtcagcttgtg
atgggaatgacagctgaaaacctggctgaagatcaccaaatttcacgaatggaacaagat
gagtttgctttagttagtcaattaaaggcaaaccttgccatcaaatcaaagacatttaaa
gaggaaattgttcccattcacgtgccacaaaaaaaaggcgagccaatcatttttgacacg
gatgaacaccctagacaaacaaccttagaaaaacttgaaagtctaaaacctgtgtttaaa
gaaaatggtaccgtaacagcagggaattcatctggattaaatgacggtgcatcgatgctg
cttgttgtatcagaaaaaaaagtcaagcaatatcagcttaaaccgttagttgaaattgtt
agtttgggcgtatcaggtgtaaagccagaccggatgggaattggcccagtcgaagcaacg
aaacaagcacttaccttagctgacattgatattaatgatattgacttagttgaactcaat
gaagcttttgcagcccaagccctcgctgttatcaaggaattgaatttgcctcaagacaaa
gtcaatataaacgggggagctattgccttaggtcatcccattggaaataccggttcgaga
atttgtgtaacgttaatacactcaatgctgaaacaaaaagcaaagtggggtttagccaca
ctttgtattgcaggaggacaaggaatttcaactatttttaagacagtttaa

DBGET integrated database retrieval system