KEGG   Bifidobacterium animalis subsp. lactis AD011: BLA_0084Help
Entry
BLA_0084          CDS       T00819                                 

Definition
lysophospholipase L2 PLDB (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bla  Bifidobacterium animalis subsp. lactis AD011
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bla00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(107887..108972)
Genome map
AA seq 361 aa AA seqDB search
MEIAMINEHEFQQDLEATALPALDSCMHDGYMDPAVSDWHGHRLRTLHPADGTPNKLHVV
RYDVEKFHALQIPGSSRQTHGTVLISHGFTEFAAKYKEMAWYFLLAGFSVCILEHRGHGY
SARDVRNDQIVYIDTWHRYVADLAKCARTIARPMAADKPLVLFAHSMGGGIAAAMLERYP
NIVDKAVLSSPMIEANLHTPNWLAALVCGAACDFGHAKSMAPGQRAFTPLIDIKDNQGAC
MQRLEWMKKLRIADTHYQTSAAANEWVRQAIRLSIAMQDPHMCERIETPILLFQAGNDHW
VRNKAQNRFVKRVGKDGGDIRMVRVPGSVHEIFTMPNSVMAPYLKEILTFLQTSEPVTVL
V
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcgcgatgatcaacgaacacgaattccagcaggatctcgaggccaccgccctg
ccggccctcgattcgtgcatgcatgacggctacatggacccggccgtctcggattggcat
gggcacagactgcgcacgctgcacccggcggacggcactccgaacaagctgcatgtcgtg
cgctacgacgtcgagaaattccatgccttgcagattcccggctcctcccgccaaacccat
ggcaccgtgctcatctcgcacggattcaccgagttcgcggccaaatacaaggagatggca
tggtacttcctgctcgccggattctccgtttgtattctcgaacaccgcgggcatggctat
tccgcgcgcgatgtgaggaacgaccagattgtgtacatcgacacatggcaccgctatgtc
gccgatctcgcgaaatgcgcgcggacgatcgcacgcccgatggcggcagacaagccgctt
gtgctgttcgcacattcgatgggcggcggcatcgcagcggccatgctcgagcggtacccc
aacatcgtcgacaaggccgtgctgtcgtcgccgatgatcgaggcgaatctgcacaccccg
aactggctcgcagcactggtgtgcggcgcggcatgcgatttcggccacgccaagtccatg
gcacccggacagcgcgcgttcacgccgctcatcgacatcaaagacaaccagggcgcatgc
atgcagcgtctcgaatggatgaagaagctgcgcatcgcagacacgcattaccagacctcg
gccgcggcgaacgagtgggtgaggcaggcgatccgcctgtccatcgccatgcaggacccg
catatgtgcgagcgcatcgagacgccaatcctgctgttccaggcaggcaatgaccactgg
gtgcgcaacaaggcgcagaatcgcttcgtcaaacgcgtgggcaaggacggcggcgacatc
cgcatggttcgcgtgcccggctccgtgcatgagatcttcacgatgccgaacagcgtgatg
gcaccgtatctgaaggagatcctcacgttcctgcaaacgagcgagccggtcaccgtgctc
gtctga

DBGET integrated database retrieval system