KEGG   Bifidobacterium animalis subsp. lactis AD011: BLA_0116Help
Entry
BLA_0116          CDS       T00819                                 

Gene name
adh
Definition
alcohol dehydrogenase (EC:1.1.1.284)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bla  Bifidobacterium animalis subsp. lactis AD011
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bla00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BLA_0116 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLA_0116 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    BLA_0116 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BLA_0116 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BLA_0116 (adh)
   00626 Naphthalene degradation
    BLA_0116 (adh)
Enzymes [BR:bla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BLA_0116 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(139329..140372)
Genome map
AA seq 347 aa AA seqDB search
MKAAVFVEPEHVGVREVERPRIEKPTDAIVRVLKACVCGSDLWWFRGISERPHNTLVGHE
AIGIIDEVGADVHDMKPGDFVIVPFTHCCGHCEACEKGYDGNCFNMEPGGNAGYQAEYMR
ATWAGTALIKIPGTPADYTDEQIASLLALSDVMATGYHAAWSSRIEPGDTVVIYGDGAVG
LCAVIGAKLLGAGRIIMMSRHEDRAALAREFGATDIVPERGDEAVARIMEMTNGAGADRV
LECVGSEQSIESAVRSGRPGAYVSRVGVPHDNSIDVNALFWRNVSLTGGIASVATHDKST
LLKAVLDGEINPGKVFTASFDLDHVQQAYEAMDGRRAIKSMIDIAEA
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgcggtgttcgtggaacccgaacacgtcggagtgcgcgaagtggagcgcccg
agaatcgagaagcccaccgacgcgattgtgcgcgtgctcaaggcatgcgtatgcggctcg
gatctgtggtggttccgcggcatctcggagcgcccgcacaacacgctcgtgggccacgag
gcgatcggcatcatcgacgaggtgggcgccgacgtgcacgacatgaagcccggcgacttc
gtgatcgttcccttcacccactgctgcgggcactgcgaggcctgcgagaagggatacgac
ggcaactgcttcaacatggagcccggcggcaatgccggctaccaggccgaatacatgcgc
gccacctgggcaggcaccgcgctcatcaagattccgggtacgcccgccgactacaccgac
gagcagatcgcctcgctgctggcgctctcggacgtcatggcgaccggctatcacgccgcg
tggagctcgaggatcgaacccggcgacaccgtggtgatctacggggacggcgccgtgggc
ctgtgcgcggtgatcggtgcgaagctgcttggcgctggcaggatcatcatgatgagccgt
catgaggatcgtgcggcacttgcccgtgaattcggcgcgaccgacatcgttcccgagcgc
ggcgacgaggcggtggcccgcatcatggagatgacgaacggcgcgggcgccgaccgcgtg
ctcgaatgcgtcggttccgagcagagcattgaatccgccgtgcgcagcggacgcccgggt
gcctatgtgagccgcgtcggcgtgccacatgacaacagcatcgacgtgaacgcgctgttc
tggcgcaatgtatcgctgaccggcggcatcgcctcggtggccacgcacgacaagagcaca
ctgctcaaggccgtgctcgacggcgaaatcaacccgggcaaggtgttcaccgcctccttc
gacctcgaccatgtgcagcaggcctatgaggcgatggacggacgccgtgccatcaagtcg
atgatcgacatcgccgaagcgtaa

DBGET integrated database retrieval system