KEGG   Bifidobacterium animalis subsp. lactis AD011: BLA_0116Help
Entry
BLA_0116          CDS       T00819                                 

Gene name
adh
Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bla  Bifidobacterium animalis subsp. lactis AD011
Pathway
bla00010  Glycolysis / Gluconeogenesis
bla00071  Fatty acid degradation
bla00350  Tyrosine metabolism
bla00625  Chloroalkane and chloroalkene degradation
bla00626  Naphthalene degradation
bla01100  Metabolic pathways
bla01110  Biosynthesis of secondary metabolites
bla01120  Microbial metabolism in diverse environments
bla01130  Biosynthesis of antibiotics
bla01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLA_0116 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    BLA_0116 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BLA_0116 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BLA_0116 (adh)
   00626 Naphthalene degradation
    BLA_0116 (adh)
Enzymes [BR:bla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BLA_0116 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ACL28419
UniProt: B8DVB8
Position
complement(139329..140372)
Genome map
AA seq 347 aa AA seqDB search
MKAAVFVEPEHVGVREVERPRIEKPTDAIVRVLKACVCGSDLWWFRGISERPHNTLVGHE
AIGIIDEVGADVHDMKPGDFVIVPFTHCCGHCEACEKGYDGNCFNMEPGGNAGYQAEYMR
ATWAGTALIKIPGTPADYTDEQIASLLALSDVMATGYHAAWSSRIEPGDTVVIYGDGAVG
LCAVIGAKLLGAGRIIMMSRHEDRAALAREFGATDIVPERGDEAVARIMEMTNGAGADRV
LECVGSEQSIESAVRSGRPGAYVSRVGVPHDNSIDVNALFWRNVSLTGGIASVATHDKST
LLKAVLDGEINPGKVFTASFDLDHVQQAYEAMDGRRAIKSMIDIAEA
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgcggtgttcgtggaacccgaacacgtcggagtgcgcgaagtggagcgcccg
agaatcgagaagcccaccgacgcgattgtgcgcgtgctcaaggcatgcgtatgcggctcg
gatctgtggtggttccgcggcatctcggagcgcccgcacaacacgctcgtgggccacgag
gcgatcggcatcatcgacgaggtgggcgccgacgtgcacgacatgaagcccggcgacttc
gtgatcgttcccttcacccactgctgcgggcactgcgaggcctgcgagaagggatacgac
ggcaactgcttcaacatggagcccggcggcaatgccggctaccaggccgaatacatgcgc
gccacctgggcaggcaccgcgctcatcaagattccgggtacgcccgccgactacaccgac
gagcagatcgcctcgctgctggcgctctcggacgtcatggcgaccggctatcacgccgcg
tggagctcgaggatcgaacccggcgacaccgtggtgatctacggggacggcgccgtgggc
ctgtgcgcggtgatcggtgcgaagctgcttggcgctggcaggatcatcatgatgagccgt
catgaggatcgtgcggcacttgcccgtgaattcggcgcgaccgacatcgttcccgagcgc
ggcgacgaggcggtggcccgcatcatggagatgacgaacggcgcgggcgccgaccgcgtg
ctcgaatgcgtcggttccgagcagagcattgaatccgccgtgcgcagcggacgcccgggt
gcctatgtgagccgcgtcggcgtgccacatgacaacagcatcgacgtgaacgcgctgttc
tggcgcaatgtatcgctgaccggcggcatcgcctcggtggccacgcacgacaagagcaca
ctgctcaaggccgtgctcgacggcgaaatcaacccgggcaaggtgttcaccgcctccttc
gacctcgaccatgtgcagcaggcctatgaggcgatggacggacgccgtgccatcaagtcg
atgatcgacatcgccgaagcgtaa

DBGET integrated database retrieval system