KEGG   Bifidobacterium animalis subsp. lactis AD011: BLA_0129Help
Entry
BLA_0129          CDS       T00819                                 

Gene name
scrP
Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
bla  Bifidobacterium animalis subsp. lactis AD011
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bla00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
154925..156445
Genome map
AA seq 506 aa AA seqDB search
MKNKVQLITYADRLGDGNLASMTDILRTRFDGVYEGVHILPFFTPFDGADAGFDPIDHTK
VDARLGDWDDIAELAKTHDIMVDAIVNHMSWQSKQFQDVLANGEDSEYYPMFLTMSSVFP
DGATEEELAGIYRPRPGLPFTHYSFAGKTRLVWVTFTPQQVDIDTDSAKGWEYLMSIFDQ
MSKSHVKYIRLDAVGYGAKEAGTSCFMTPKTFELISRLREEGAKRGLEILIEVHSYYKKQ
VEIAAKVDRVYDFALPPLLLHSLFTGKVDALAHWTEIRPNNAVTVLDTHDGIGVIDIGSD
QLDRSLKGLVPDADVDNMVETIAKNTHGESKAATGAAASNLDLYQVNSTYYSALGCNDQH
YIAARAVQFFLPGVPQVYYVGALAGENDMELLKRTNVGRDINRHYYTTSEIDKNLERPVV
KALNALARFRNELPAFDGDFSYSVGDDESIAFSWNGFGSSATLTFTPSKGMGVENPQSVA
TLVWTDSTGEHRTDDLIANPPVMQAS
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacaaagttcagctgatcacctatgcggatcgcttgggtgacggcaaccttgct
tcgatgaccgacattctgcgcacgcgattcgacggcgtgtacgagggcgtgcacattctg
ccgttcttcaccccgttcgatggcgcggacgcaggcttcgacccgatcgaccacaccaag
gtcgacgcccgcctcggtgactgggatgacatcgccgagctcgccaagacgcatgacatc
atggtcgatgccatcgtcaaccacatgagctggcagtccaagcagttccaggatgtgctc
gcgaacggcgaggattccgagtactacccgatgttcctcacgatgagctccgtgttcccc
gacggcgcgaccgaggaggagctcgccggcatctaccgcccgcgcccgggcctgccgttc
acccactacagcttcgccggcaagacccgcttggtgtgggtcacgttcacgccgcagcag
gtcgacattgacaccgactccgccaagggctgggaatacctgatgtcgatcttcgaccag
atgagcaagtcgcacgtcaagtacattcgcctcgacgccgtcggctacggcgccaaggag
gccggcaccagctgcttcatgacccccaagaccttcgaactcatctcgcgactgcgcgag
gagggtgccaagcgcggtctggagattctcatcgaggtgcactcgtactacaagaagcag
gtggagatcgccgccaaggtggatcgcgtctatgacttcgcgctgccgccattgctgctg
cactcgctgttcaccggcaaggtggacgcgctcgcgcactggaccgagattcgcccgaac
aatgcggtcaccgtgctcgacacgcacgacggcatcggcgtcatcgacatcggctccgac
cagctcgaccgttcgctcaagggtctggtgcccgacgcggacgtcgacaacatggtcgag
acgatcgcgaagaacacccatggcgagtcgaaggccgcaaccggcgccgccgcttcgaac
ctcgacctctaccaggtgaactccacatattattcggcgctcggctgcaatgaccagcat
tacattgccgcacgcgccgtgcagttcttcctgccgggcgttccgcaggtgtactatgtg
ggcgcgctcgccggcgagaacgacatggagctgctcaagcgcacgaatgtgggccgcgac
atcaaccgccactattacacgacctccgagatcgacaagaacctcgaacgtccggtggtc
aaggccctgaacgcgctcgccagattccgcaacgagctgccggcgttcgacggcgacttc
agctactcggtgggcgatgacgagtcgattgcgttctcctggaacggtttcggatcctcc
gctacgctcacgttcacgccgtccaagggcatgggtgtcgagaacccacagtccgtcgcc
acgctcgtctggacggattccactggcgagcaccgcaccgacgacctcattgcgaacccg
cccgtcatgcaggcgagctga

DBGET integrated database retrieval system