KEGG   Bifidobacterium animalis subsp. lactis AD011: BLA_0202Help
Entry
BLA_0202          CDS       T00819                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bla  Bifidobacterium animalis subsp. lactis AD011
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bla00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BLA_0202 (recR)
DNA repair and recombination proteins [BR:bla03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BLA_0202 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
247979..248581
Genome map
AA seq 200 aa AA seqDB search
MALAYDGAIQRLIDSFASLPGIGPKGAQRIAFYLLQAPDAESQRLVDAINEVKEKVRFCE
VCGNVCESSPCTICSDPRRDHGTICVVEEPKDVMSIERTREYRGLYQVLGGAINPMANVG
PSDLNIAQLLNRLHDGEVKEIIVALNPNIEGEATTTYLSRLLAPLDIKVTRLASGLPVGG
DLEYADEITLSRALEGRREV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcattggcatacgacggcgccatccagcggctcatcgactcgtttgcgagtctgccg
ggcatagggcccaaaggagcgcaacgcatcgccttctatctgctgcaggcgccggatgcg
gagtcgcagcgcctcgtcgacgcaatcaacgaggtgaaggagaaagtacggttctgcgaa
gtctgcgggaatgtgtgcgaaagcagcccgtgcacaatctgctcggatccgcgtcgtgat
cacggcacgatctgcgtggtggaggagccgaaggacgtcatgagcatcgaacgcacgcgc
gaataccgcgggctctaccaggtgctgggcggcgccatcaacccgatggccaacgtcggc
ccgagcgacctcaacatcgcgcagctgctcaacagactccacgacggcgaggtcaaggag
atcatcgtggcgctcaatccgaacatcgagggggaggcaaccaccacctacctgagccgc
ctgctcgcgccgctcgacatcaaggtgacgcgtctggcgagcggtctgccggtgggcggc
gacctcgagtacgccgacgaaatcacgttgtctcgcgcgctcgaagggcgtcgtgaggtg
tga

DBGET integrated database retrieval system