KEGG   Bifidobacterium animalis subsp. lactis AD011: BLA_0202Help
Entry
BLA_0202          CDS       T00819                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
bla  Bifidobacterium animalis subsp. lactis AD011
Pathway
bla03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bla00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BLA_0202 (recR)
DNA repair and recombination proteins [BR:bla03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     BLA_0202 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BLA_0202 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 DUF3701
Motif
Other DBs
NCBI-ProteinID: ACL28504
UniProt: B8DVK3
Position
247979..248581
Genome map
AA seq 200 aa AA seqDB search
MALAYDGAIQRLIDSFASLPGIGPKGAQRIAFYLLQAPDAESQRLVDAINEVKEKVRFCE
VCGNVCESSPCTICSDPRRDHGTICVVEEPKDVMSIERTREYRGLYQVLGGAINPMANVG
PSDLNIAQLLNRLHDGEVKEIIVALNPNIEGEATTTYLSRLLAPLDIKVTRLASGLPVGG
DLEYADEITLSRALEGRREV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcattggcatacgacggcgccatccagcggctcatcgactcgtttgcgagtctgccg
ggcatagggcccaaaggagcgcaacgcatcgccttctatctgctgcaggcgccggatgcg
gagtcgcagcgcctcgtcgacgcaatcaacgaggtgaaggagaaagtacggttctgcgaa
gtctgcgggaatgtgtgcgaaagcagcccgtgcacaatctgctcggatccgcgtcgtgat
cacggcacgatctgcgtggtggaggagccgaaggacgtcatgagcatcgaacgcacgcgc
gaataccgcgggctctaccaggtgctgggcggcgccatcaacccgatggccaacgtcggc
ccgagcgacctcaacatcgcgcagctgctcaacagactccacgacggcgaggtcaaggag
atcatcgtggcgctcaatccgaacatcgagggggaggcaaccaccacctacctgagccgc
ctgctcgcgccgctcgacatcaaggtgacgcgtctggcgagcggtctgccggtgggcggc
gacctcgagtacgccgacgaaatcacgttgtctcgcgcgctcgaagggcgtcgtgaggtg
tga

DBGET integrated database retrieval system