KEGG   Bifidobacterium animalis subsp. lactis AD011: BLA_0233Help
Entry
BLA_0233          CDS       T00819                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bla  Bifidobacterium animalis subsp. lactis AD011
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bla00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bla00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
293519..294847
Genome map
AA seq 442 aa AA seqDB search
MDVEKTDDVLHVVGGKPLNGTIKVRGAKNFVSKAMVAALLAPGTSVLKNVPEIRDVHVVS
DLLRLHGVNVDVNGDEGIVTIDAKNVQLADVADVDTLSGSSRIPILFSGPLLHRLGEAFI
PALGGCNIGGRPIDFHLETLRKLGATVDKEHKDGIHITAPNGLHGAKIHLPYPSVGATEQ
TLLAAVLADGKTELSGAATEPEIMDLVAVLQKMGAIISVDVDRTFRIEGVKELKGYTHTA
LTDRIEAASWASAALATHGDVFVKGATQPEMMTFLNVFRKIGGEFDITDRGIRFWHPGGD
LKPVAIETDVHPGFMTDWQQPLVVALTQANGLSIVHETVYENRFGFTKPLVEMGATVQLY
RECLGSLPCRFQQRNYKHSAVIFGPTPLEGRDIDVPDLRGGFSHLIAALAAKGPSDVRGI
SLIDRGYADFRGKLTALGAQID
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
gtggacgtggagaaaactgacgacgtactgcatgtggtgggcggcaagccgctcaacggc
acgatcaaggtgcgcggtgcgaagaacttcgtaagcaaggccatggtggcggctctgctc
gcgccggggacgtcggtgctcaaaaacgtgcccgaaatacgagacgtgcatgtggtttcg
gatctgctgcgtctgcacggcgtgaacgtggacgtgaacggcgacgagggcattgtgacg
atcgacgcgaagaacgtgcagctggccgacgtggccgatgtagacacgctctccggctcg
tcgcgcattccgatcctgttctcgggcccgctgctgcaccggctgggcgaggcgttcatc
ccggcgctcggcggctgcaacattggcggccggccgatcgacttccatttggagacactg
cgcaaactcggcgccaccgttgacaaggaacacaaggacggcattcacatcaccgcgccg
aacggtctgcacggcgcgaagatccacctgccgtacccgtcggtgggcgcgaccgagcag
actctgctcgccgccgtgctcgcagatggcaagaccgagctgtccggcgcggcgaccgaa
ccggagatcatggacttggtggccgtgctgcagaagatgggcgcgatcatctcggtggac
gtggaccgcacgttccgcatcgagggcgtgaaggagctgaagggctacactcacacggct
ctcaccgaccgcattgaggcggcgtcgtgggcgtcggccgcgctcgccacacacggcgac
gtgttcgtgaagggcgcgacgcagccggagatgatgacgttcctcaatgtgttccgcaaa
atcggcggcgagttcgacatcaccgaccgcggcatccgcttctggcacccgggcggcgac
ctgaagccggtggcgatcgagaccgacgtgcaccccggcttcatgaccgactggcagcag
ccgctcgtcgtggcgctcacgcaggcgaacgggctgagcattgtgcatgagaccgtgtac
gagaaccgtttcggtttcacgaagccgctggtggagatgggcgcaaccgtgcagctctac
cgcgaatgcctcggctcgttgccgtgccgcttccagcagcgcaactacaagcattccgct
gtgatcttcgggccgacgccgctcgaagggcgcgacatcgacgtgccggatctgcgcggt
ggattcagccacctgatcgcggcgctggcggcgaagggaccgtccgacgtgcgcggcatc
agcctgatcgaccgcgggtacgcggacttccgcggcaagctcacggcgctcggcgcgcag
atcgactag

DBGET integrated database retrieval system