KEGG   Bifidobacterium animalis subsp. lactis AD011: BLA_0286Help
Entry
BLA_0286          CDS       T00819                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bla  Bifidobacterium animalis subsp. lactis AD011
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bla00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLA_0286 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    BLA_0286 (dapE)
Enzymes [BR:bla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BLA_0286 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
366593..367804
Genome map
AA seq 403 aa AA seqDB search
MIDRAGEPLKLTVDAGVGEQAALTDLCMQVMRVYSVSDDETHLTDMTEAFLRTLPHLDVQ
RHGDTLVARTNLGRDRRVVLAGHLDVVPVIDNFPPKLLEPGDPLILPGVAEAHPGERVVW
GRGATDMKSSDAVLLYLAATLTNPKYDLTYVFYDHEEVAAEKNGLRKVAEAHPDWIAGDF
AIIGEPTSCGIEGGCNGTIRFDVVTHGIAAHSARAWMGHNAIHDAAEILRRLNEHTDATV
SVDGLVYREGLNATLISGGKGTNVIPDECRVHVNYRFAPDKSLAEAKALMMGADCGAELG
NGEHQATGGVFEGFGIEMKDESPSARPGMDSELTRSLAALAKARTGKDPEAKLGWTDVAR
FSQLGVPAVNFGAGSPLLAHKHDEQVAEGELTLMAGILRDWLS
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgatcgcgcgggggagccgctcaagctgacggtggacgccggtgtgggcgagcag
gccgcgctcaccgacctgtgcatgcaggtgatgcgcgtgtactcggtgagcgacgacgag
acgcatctgaccgacatgaccgaggcgttccttcgcacgctgccgcatctggacgtgcag
cggcatggcgacacgctcgtcgcgcgcacgaatctcggccgtgacaggcgcgtggtgctc
gccggccatctcgatgtggtgccggtgatcgacaacttcccgccgaaactgctcgaaccc
ggagacccgctcattctgccgggcgtcgcggaggcgcacccgggcgaacgcgtggtgtgg
ggacgtggcgccaccgacatgaaatcgtcggacgccgtgctgctttaccttgccgcgacg
ctgacgaacccgaaatacgatctgacttacgtgttctacgaccacgaggaggtggccgcc
gagaagaacggcctgcgcaaggtcgccgaagcgcacccggactggatcgccggcgatttc
gcgatcataggcgagcccacctcatgcggcattgaaggcggctgcaacggcacgatccgc
ttcgacgtggtcacgcacggcatagccgcacattccgcacgcgcgtggatgggccacaac
gccatccacgacgccgccgagattctgcgccgtctgaacgagcatacggacgccactgtg
agcgtggacggtctcgtctaccgcgaagggctcaacgcgacgctgatcagcggcggcaag
ggcaccaatgtgatccccgatgaatgccgcgtgcacgtcaactaccgtttcgctcccgac
aaatcgctcgccgaggcgaaggcgctgatgatgggcgcagactgcggtgccgaactcggc
aacggcgagcaccaggcgacgggcggtgtgttcgagggcttcggcattgagatgaaagac
gaatcgccgtcggcacgacccggcatggattccgaactcacgcgctcgctggcggctctg
gcgaaggcacgcaccggcaaggaccccgaggcgaagctcggctggaccgacgtcgcccga
ttctcgcagctcggtgttccggccgtcaacttcggcgccggttcgccactgctcgcgcac
aagcacgacgagcaggtggcggaaggcgaactgacgctcatggccggcattctgcgcgac
tggctgagctga

DBGET integrated database retrieval system