KEGG   Bifidobacterium animalis subsp. lactis AD011: BLA_0291Help
Entry
BLA_0291          CDS       T00819                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bla  Bifidobacterium animalis subsp. lactis AD011
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bla00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLA_0291 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BLA_0291 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BLA_0291 (proB)
Enzymes [BR:bla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BLA_0291 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
374998..376131
Genome map
AA seq 377 aa AA seqDB search
MQTPSQEEVRRAVAAARTVVVKVGSSSLTQPSGHLDVDKLNALVGAIAQVRMLGGNIVLV
SSGAIAAGFGPLGFESRPTDVATQQATASVGQGLLMAQYEMAFGRYGIRVGQLLITAEDT
MQPRQYRNARRTMAKLLELGVVPIVNENDALASNEIRFGDNDRLSALIANMVRADALILL
TDVDALYTAPPSEPGSHRIGFVPNITELLDQVRVGGSESGVGTGGMVTKLEAARMAAVSG
IPAVLTAARNAGPALMGDEVGTAFAPVKQRGSARRLWIKFAAHPRGVLVADSGAAKAVRG
GRASLLAAGVLESRGDFAAGDPVWIDDEAGNHLARGLAGYDSEEIPNMLGRNTAQLRRLL
GEEYAHPLVHRDNLVLV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccccgtcccaggaggaagtacgccgggcggtggcagccgcgcgaaccgtggtg
gtgaaggtggggtcgagctcgctcacgcagccgtccgggcacttggacgtagacaagctc
aatgcgctggtgggcgcgatcgcgcaggtgcgcatgctcggcggcaacatcgtgctcgtc
tcgtccggcgccatcgccgcgggtttcggtccgctcggcttcgaatcgcgccccaccgat
gtggccacacagcaggcgaccgcgtcggtggggcaggggctgctcatggcccagtacgag
atggcgttcggccgctacggcattcgcgtgggccagctgctcatcaccgccgaagacacg
atgcagccacggcagtaccgcaatgcgcggcgcaccatggccaagctgctcgaactcggt
gtggtgccgatagtcaacgagaacgatgcgcttgccagcaacgagatccgtttcggcgac
aacgaccggctttccgcgctcatcgcgaacatggtgcgtgccgacgcgctgattctgctc
accgatgtcgacgcgctctacaccgcacccccaagcgaaccgggctcccatagaatcggc
ttcgtgccgaacatcaccgaactgctcgatcaggtgcgtgtgggcggttcagagtcgggc
gtgggcaccggcggtatggtcacgaagctcgaggccgcgcgcatggccgccgtctccggc
attccggccgtgctcaccgccgcccgcaacgccggtccggcactcatgggcgatgaggtg
ggcacggcattcgctccggtgaagcaacgcggttcggcgcgcaggttgtggatcaaattc
gcggcccatccgcgtggagtgctcgtggccgattccggcgcggccaaggcggtgcgcggc
ggacgggcgagtctgcttgctgcgggtgtgctcgaatcgcgtggtgatttcgccgccggc
gacccggtgtggatcgacgacgaggcgggcaatcatctggcgcgcggccttgccggttac
gattccgaggagattccgaatatgctcggacgcaacaccgcacagctgcgccgcctgctt
ggcgaggaatatgcgcacccgctcgtgcaccgcgacaatctcgtgctcgtgtga

DBGET integrated database retrieval system