KEGG   Bifidobacterium animalis subsp. lactis AD011: BLA_0353Help
Entry
BLA_0353          CDS       T00819                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bla  Bifidobacterium animalis subsp. lactis AD011
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bla00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BLA_0353 (malQ)
Enzymes [BR:bla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BLA_0353 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
455415..457583
Genome map
AA seq 722 aa AA seqDB search
MAELNEESPERLARPLIRLAQSLGVATSYVGMSRDFHEIPDDVLVAVLKALNVDASSEET
IEVSLEHVNNQRAMRLIEPTVLHIVGEQSHVPIHLAITEAPKVTITLEDGTIYQHDIAVE
PLPDVKVHEVNGKFFSTAQIALPADLPEGYHTLHIAAGQREADATLISAPQRIPLLDPLK
NGSLWGWMAQLYSIRSADSWGVGDFADLRTLLIDSKRYTNADFMLINPVHAGEPVSPLTP
SPYLPVSRRFINYTYIHPEDIPEYYALDDAAKQSVKDAHAKMEAYNADPNLIDRDAMWLE
KEKALRTIFNTGLQSVRQQAFDDYKARCGEDLEAYATWCVCYAKWGKPENTPDNWINKYT
KDSPEVKQLREQNSDLLEFYRWLEWIAVEQMHAAQQAARQAGMKIGIMSDMAVGVHPDGS
EVWWNPERFANGATVGAPPDMFNQQGQNWSQPPLSPLSLKETGYKAYREMVRGMFDCAGA
VRIDHILGLFRLWWIPEGQPASNGTYVYYDHNTMLGILAIEADRVGGLIVGEDLGVVPSY
VQQSLADYAIFGCAVEWFEQMDGVFIPPKDWRPYALASVDNHDMPPAAGYLEYEHVRVRE
QLGLLGEDSSAFERSARAEHQAMLQMLVDNGYLDVNVMKDESGRWEEIVEALYRALNSSP
CKLKAVSFVDAVGERRTQNQPGTDNEYPNWRVPLADYHGDNVPLEHLFDSDLLQRIAKIM
NS
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggcagaactcaacgaagaaagcccggagcgtcttgcgcgcccccttattcgtctcgcg
cagtcgctgggcgtggcgaccagttatgtcggcatgtcgcgtgatttccatgagattccc
gatgacgtgctcgtggccgtgctgaaggccctgaatgtcgatgcctccagcgaggagacc
atcgaagtgtcgttggaacatgtgaacaaccagcgcgccatgcggctcatcgaacccacc
gtgctgcacattgtgggcgagcagagtcacgtgcccatccatctggccatcaccgaggcg
ccgaaggtcacgatcacactcgaagacggcaccatataccaacacgacatcgcggtggag
ccgctgcccgacgtcaaggtgcatgaagtcaacggcaagttcttctcgacggcgcagatc
gcactgcctgccgacctgcccgagggctaccacacgctgcatatcgcggcagggcagcgc
gaggcggatgcgacgctgatcagcgcgccacagcgcatcccactgctcgatccgctcaag
aacgggtcgttgtggggctggatggcccagttgtattcgatccgctcggccgactcctgg
ggcgtcggcgatttcgccgatctgcgcacgttgctcatcgactcgaagcggtacacgaac
gccgacttcatgctcatcaaccctgtgcatgccggcgaaccggtctcaccgctgaccccg
tcgccatacctaccggtgtcgcgtcgcttcatcaactacacctacattcacccggaggac
attccggagtactacgcgttggacgatgccgccaagcagtccgtcaaggacgcgcacgcc
aagatggaggcctacaacgccgatccgaacctgatagaccgcgatgccatgtggctggag
aaagagaaggcgctgcgcacgatcttcaacacgggcctgcagtcggtgcgccagcaggcc
ttcgacgactacaaggccaggtgcggcgaggacctcgaggcatacgccacctggtgcgtc
tgctatgcgaagtggggcaagccggagaacacgccagacaattggatcaacaagtacacg
aaggattcccccgaggtcaagcagctgcgcgagcagaacagcgacctgctcgaattctac
cgttggctcgagtggattgcggtcgagcagatgcatgcggcccagcaggcggcacgtcag
gccggcatgaagatcggcatcatgagcgacatggctgtgggcgtgcatcccgacggctcc
gaggtgtggtggaacccggagcgattcgccaatggcgccaccgtgggtgcgccgccggac
atgttcaaccagcaggggcagaactggagccaacccccgttgagcccgctgtcgctcaag
gaaaccggctacaaggcgtaccgcgagatggtgcgtggcatgttcgactgcgccggtgct
gtgcgcatcgaccacattctcggcctgttccgcctgtggtggatcccggagggccagccg
gcctcgaatggcacctacgtgtactacgaccacaacacgatgctgggcattctcgcaatc
gaagcagaccgtgttggtggtctgatcgtgggtgaggacctcggtgtcgtgccgtcgtac
gtgcagcagtcgctcgccgactatgccatcttcggctgcgccgtcgaatggtttgagcag
atggatggcgtgttcattccgccgaaggattggcgcccgtatgcgttggcctcggtggac
aaccacgacatgccgccggctgccggctatctcgagtacgagcatgtgcgcgtgcgcgag
cagctcggtctgctcggcgaggattcgtcggccttcgagcgcagcgcgcgcgccgagcat
caggccatgctgcagatgctcgtcgacaacggctacctcgatgtcaatgtgatgaaagac
gaatccggcaggtgggaggagatcgtcgaggcgctctaccgtgcgctcaacagctcgcct
tgcaagctcaaggccgtctccttcgtcgacgcggtgggagaacgccgcacgcagaaccag
ccgggcaccgacaacgagtatccgaactggcgtgtgccgttggccgactaccacggcgac
aacgtgccgctcgagcacctgttcgactccgatctgctgcagcgcatcgccaagatcatg
aacagctga

DBGET integrated database retrieval system