KEGG   Bifidobacterium animalis subsp. lactis AD011: BLA_0401Help
Entry
BLA_0401          CDS       T00819                                 

Gene name
serS
Definition
seryl-tRNA synthetase (EC:6.1.1.11)
Orthology
K01875  
seryl-tRNA synthetase [EC:6.1.1.11]
Organism
bla  Bifidobacterium animalis subsp. lactis AD011
Pathway
Aminoacyl-tRNA biosynthesis
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:bla00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(498914..500200)
Genome map
AA seq 428 aa AA seqDB search
MLDIQFIREHPEVVKESQRKRGESVELVDEVLRADEERRSSLKQFEEARARQKEIGKQVA
KAAPDEKAKLIAQTKELSEQVASFKASADTADEQYTTAMWQLSNIVEPQAPEGGEDDYVV
MRKVGQIRDFAAEGFEPKDHLTLGEEVAGIDMKRGVKVSGSRFYFLRGDVARLQIAMLTM
AVDQAQEHGFILAITPTLVRPEVMRGTGFLNSHADEIYRLREPDDDYLVGTSEVALAGMH
ENEILDLSDGPLRYCGWSSCYRREAGAAGKDTSGIIRVHQFDKVEMFVYAKPENSDAEHQ
KLLAMEEEMLAKVEVPYRVIDTAAGDLGSSAARKFDCEAWVPTQGRYRELTSTSNCTQYQ
ARRLNIRERVADGGTSPVATLNGTLATTRWLVAILENHQQADGSIEIPKAMRPYMGGKEV
IEPRKWEA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatattcaattcattcgtgaacatcctgaagtagtcaaggaatcacaacgcaaa
cgcggcgaatccgtcgaactcgtcgacgaggtgctccgtgccgacgaggaacgccgctcc
tcgctcaagcaattcgaagaggcccgcgcccgccagaaggagatcggcaagcaggtcgcc
aaggccgcaccggatgagaaggcgaagctgatcgcgcagaccaaggagctctccgaacag
gtcgcctcgttcaaagcaagcgccgacaccgccgacgaacagtacaccaccgcgatgtgg
cagctgtcgaacatcgtggaaccacaggcgccggaaggcggcgaagacgactacgtggtg
atgaggaaggtcggtcagatccgcgatttcgcagccgagggcttcgagccgaaagaccac
ctcaccctcggcgaggaggtcgccggcatcgatatgaagcgcggtgtgaaggtctccggt
tcccgtttctacttcctgcgcggcgatgtggcacgtctgcagatcgccatgctcacgatg
gcggtggatcaggcacaggagcacggtttcatccttgcgatcacacctacgctcgtgcgt
ccggaggtcatgcgcggcaccggcttcctcaactcgcacgccgatgagatctaccgtctg
cgcgagccggacgacgactatctggtgggcacttcggaggtcgcgcttgctggcatgcac
gagaacgagattctcgacctgagcgacggtccgctgcgctactgcggatggagctcctgc
tatcgtcgcgaggcgggcgccgcaggcaaggacacgagcggcatcattcgcgtccaccag
ttcgacaaggtggagatgttcgtctatgccaagccggagaactccgatgccgagcaccag
aagcttctcgcgatggaggaggagatgctcgccaaggtggaagtcccgtaccgcgtaatc
gacacggccgcgggcgatctgggttcctcggcagcacgcaagttcgactgcgaggcctgg
gttcccacgcagggccgctaccgcgagctcacgtccacctcgaactgcacgcagtaccag
gcacgccgactcaacattcgcgagcgcgttgccgacggcggcacctcccctgtcgccacg
ctcaacggcaccttggccaccacccgctggcttgtggcgattctcgagaaccaccagcag
gccgacggttcgatcgagatcccgaaggccatgcgtccgtacatgggcggcaaggaagtg
atcgagccgcgcaagtgggaggcctga

DBGET integrated database retrieval system