KEGG   Bifidobacterium animalis subsp. lactis AD011: BLA_0401Help
Entry
BLA_0401          CDS       T00819                                 

Gene name
serS
Definition
seryl-tRNA synthetase (EC:6.1.1.11)
Orthology
K01875  
seryl-tRNA synthetase [EC:6.1.1.11]
Organism
bla  Bifidobacterium animalis subsp. lactis AD011
Pathway
Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bla00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    BLA_0401 (serS)
Enzymes [BR:bla01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.11  serine---tRNA ligase
     BLA_0401 (serS)
Amino acid related enzymes [BR:bla01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   BLA_0401 (serS)
Transfer RNA biogenesis [BR:bla03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BLA_0401 (serS)
 Prokaryotic Type
    BLA_0401 (serS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(498914..500200)
Genome map
AA seq 428 aa AA seqDB search
MLDIQFIREHPEVVKESQRKRGESVELVDEVLRADEERRSSLKQFEEARARQKEIGKQVA
KAAPDEKAKLIAQTKELSEQVASFKASADTADEQYTTAMWQLSNIVEPQAPEGGEDDYVV
MRKVGQIRDFAAEGFEPKDHLTLGEEVAGIDMKRGVKVSGSRFYFLRGDVARLQIAMLTM
AVDQAQEHGFILAITPTLVRPEVMRGTGFLNSHADEIYRLREPDDDYLVGTSEVALAGMH
ENEILDLSDGPLRYCGWSSCYRREAGAAGKDTSGIIRVHQFDKVEMFVYAKPENSDAEHQ
KLLAMEEEMLAKVEVPYRVIDTAAGDLGSSAARKFDCEAWVPTQGRYRELTSTSNCTQYQ
ARRLNIRERVADGGTSPVATLNGTLATTRWLVAILENHQQADGSIEIPKAMRPYMGGKEV
IEPRKWEA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatattcaattcattcgtgaacatcctgaagtagtcaaggaatcacaacgcaaa
cgcggcgaatccgtcgaactcgtcgacgaggtgctccgtgccgacgaggaacgccgctcc
tcgctcaagcaattcgaagaggcccgcgcccgccagaaggagatcggcaagcaggtcgcc
aaggccgcaccggatgagaaggcgaagctgatcgcgcagaccaaggagctctccgaacag
gtcgcctcgttcaaagcaagcgccgacaccgccgacgaacagtacaccaccgcgatgtgg
cagctgtcgaacatcgtggaaccacaggcgccggaaggcggcgaagacgactacgtggtg
atgaggaaggtcggtcagatccgcgatttcgcagccgagggcttcgagccgaaagaccac
ctcaccctcggcgaggaggtcgccggcatcgatatgaagcgcggtgtgaaggtctccggt
tcccgtttctacttcctgcgcggcgatgtggcacgtctgcagatcgccatgctcacgatg
gcggtggatcaggcacaggagcacggtttcatccttgcgatcacacctacgctcgtgcgt
ccggaggtcatgcgcggcaccggcttcctcaactcgcacgccgatgagatctaccgtctg
cgcgagccggacgacgactatctggtgggcacttcggaggtcgcgcttgctggcatgcac
gagaacgagattctcgacctgagcgacggtccgctgcgctactgcggatggagctcctgc
tatcgtcgcgaggcgggcgccgcaggcaaggacacgagcggcatcattcgcgtccaccag
ttcgacaaggtggagatgttcgtctatgccaagccggagaactccgatgccgagcaccag
aagcttctcgcgatggaggaggagatgctcgccaaggtggaagtcccgtaccgcgtaatc
gacacggccgcgggcgatctgggttcctcggcagcacgcaagttcgactgcgaggcctgg
gttcccacgcagggccgctaccgcgagctcacgtccacctcgaactgcacgcagtaccag
gcacgccgactcaacattcgcgagcgcgttgccgacggcggcacctcccctgtcgccacg
ctcaacggcaccttggccaccacccgctggcttgtggcgattctcgagaaccaccagcag
gccgacggttcgatcgagatcccgaaggccatgcgtccgtacatgggcggcaaggaagtg
atcgagccgcgcaagtgggaggcctga

DBGET integrated database retrieval system